Recombinant Human Potassium-transporting ATPase subunit beta(ATP4B),Partial

In Stock
Code CSB-EP002343HUe1
Product Type Recombinant Protein
Size US$1892
Uniprot No. P51164
Lead Time 3-7 business days
Relevance Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK
Research Area Signal Transduction
Source E.coli
Gene Names ATP4B
Protein Names Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain
Expression Region 58-291aa
Tag Info NO-Tagged
Mol. Weight 26.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.
Subcellular Location Cell membrane, Single-pass type II membrane protein
Protein Families X(+)/potassium ATPases subunit beta family
Database Links

HGNC: 820

OMIM: 137217

KEGG: hsa:496

STRING: 9606.ENSP00000334216

UniGene: Hs.434202

Pathway Oxidative Phosphorylation

Q&A and Customer Reviews

Q&A
Q:

I'm interested in the protein cat#CSB-EP002343Hue1 This protein is unlabeled, is the protein stable?

A:
Thanks for your inquiry. CSB-EP002343HUe1 We have not verified the stability of this protein after label removal, but this protein was used by other customers before tag removal, and it did not reflect the quality problem of the protein.
Customer Reviews

Related Products

ATP4B Antibodies

ATP4B Antibodies for Homo sapiens (Human)

ATP4B Proteins

ATP4B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.