Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 (HERC1), partial

In Stock
Code CSB-EP613601HU
Abbreviation Recombinant Human HERC1 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
HERC1; Probable E3 ubiquitin-protein ligase HERC1; EC 2.3.2.26; HECT domain and RCC1-like domain-containing protein 1; HECT-type E3 ubiquitin transferase HERC1; p532; p619
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3975-4360aa
Target Protein Sequence
GMDEQIMSWATSRPEDWHLGGKCDVYLWGAGRHGQLAEAGRNVMVPAAAPSFSQAQQVICGQNCTFVIQANGTVLACGEGSYGRLGQGNSDDLHVLTVISALQGFVVTQLVTSCGSDGHSMALTESGEVFSWGDGDYGKLGHGNSDRQRRPRQIEALQGEEVVQMSCGFKHSAVVTSDGKLFTFGNGDYGRLGLGNTSNKKLPERVTALEGYQIGQVACGLNHTLAVSADGSMVWAFGDGDYGKLGLGNSTAKSSPQKIDVLCGIGIKKVACGTQFSVALTKDGHVYTFGQDRLIGLPEGRARNHNRPQQIPVLAGVIIEDVAVGAEHTLALASNGDVYAWGSNSEGQLGLGHTNHVREPTLVTGLQGKNVRQISAGRCHSAAWTA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Probable E3 ubiquitin-protein ligase HERC1 is produced in an E.coli expression system. The protein features a 10xHis-tag at the N-terminus and a Myc tag at the C-terminus. This partial protein covers amino acids 3975-4360 and reaches a purity level greater than 85%, as confirmed by SDS-PAGE analysis. It's designed for research purposes and appears to offer a solid tool for studying protein interactions and modifications, with low endotoxin levels that may be beneficial for cell-based studies.

HERC1 belongs to the ubiquitin-protein ligase family. It seems to play an important role in the ubiquitination process, which targets proteins for degradation through the proteasome pathway. This protein likely participates in various cellular pathways and processes, which makes it particularly interesting for research into protein regulation and cellular homeostasis. Studying HERC1 could potentially improve our understanding of cellular mechanisms and how proteins are managed throughout their lifecycle.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human HERC1 is a large E3 ubiquitin ligase that requires precise folding, proper domain organization (including potential HECT domain functionality), and specific tertiary structure for its enzymatic activity. The E. coli expression system cannot provide the eukaryotic folding environment, chaperones, or post-translational modifications necessary for the correct folding of this complex mammalian protein. The partial fragment (3975-4360aa) may contain functional domains, but the dual N-terminal 10xHis and C-terminal Myc tags are likely to cause steric interference with domain folding and functional sites. The probability of correct folding with functional ubiquitin ligase activity is extremely low without experimental validation.

1. Antibody Development and Validation

This application is conditionally suitable. Antibody development relies on antigenic sequence recognition. The fragment can generate antibodies, but the immune response may primarily target the tags or linear epitopes due to potential misfolding. Antibodies may not recognize natively folded, full-length HERC1 in physiological contexts.

2. Structural and Biochemical Characterization

Basic biophysical characterization can be performed, but will not reflect native HERC1 structure. The tags will dominate physical properties, and the results will describe an artificial construct. Techniques like CD spectroscopy or DLS can assess folding state, but cannot confirm functional conformation.

Final Recommendation & Action Plan

This E. coli-expressed HERC1 fragment with dual tags is unsuitable for functional studies due to the high probability of misfolding in the prokaryotic system and severe tag interference. Application 1 has limitations for generating conformation-specific antibodies. Application 2 can only provide basic physical data on the recombinant construct. For reliable HERC1 research, use full-length or larger domain constructs expressed in mammalian systems that support proper folding and avoid tag artefacts.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in membrane trafficking via some guanine nucleotide exchange factor (GEF) activity and its ability to bind clathrin. Acts as a GEF for Arf and Rab, by exchanging bound GDP for free GTP. Binds phosphatidylinositol 4,5-bisphosphate, which is required for GEF activity. May also act as a E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.
Gene References into Functions
  1. In the light of recent reports of HERC1 mutations in two families with a similar phenotypic presentation, this report reiterates the pathogenic nature and clinical consequences of HERC1 disruption. PMID: 27108999
  2. Biallelic sequence variants in a novel gene (HERC1) are linked to a syndromic form of overgrowth and intellectual disability. PMID: 26138117
  3. Data show that E3 ubiquitin-protein ligase HERC1 interacts with bcl-2 homologous antagonist-killer protein BAK in HPV5 E6-expressing cells that have been damaged by UV. PMID: 25408501
  4. physical interaction between the HECT domain of HERC1, a giant protein involved in intracellular membrane traffic, and the M2 isoform of glycolytic enzyme pyruvate kinase (M2-PK) PMID: 12650930
  5. HERC1 overexpression does not stimulate protrusion formation in the absence of AlF(4)(-), in conditions where ARNO does, indicating that HERC1 is not acting as an ARF6-GEF, but instead its recruitment takes place downstream of ARF6 activation PMID: 14960311
  6. HERC1, through its RLD1 (RCC1-like domain), stimulates GDP release from ARF6 but it inhibits GDP/GTP exchange on ARF6 under conditions where ARNO stimulates it. PMID: 15642342
  7. global frequency distributions of 4 single nucleotide polymorphisms in the HERC1 gene; 12 population groups included PMID: 19618402

Show More

Hide All

Involvement in disease
Macrocephaly, dysmorphic facies, and psychomotor retardation (MDFPMR)
Subcellular Location
Membrane; Peripheral membrane protein. Cytoplasm, cytosol. Golgi apparatus. Note=Recruited onto actin-rich surface protrusions.
Tissue Specificity
Widely expressed.
Database Links

HGNC: 4867

OMIM: 605109

KEGG: hsa:8925

STRING: 9606.ENSP00000390158

UniGene: Hs.210385

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*