Recombinant Human Prosaposin(PSAP),partial

Code CSB-YP018836HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P07602
Relevance Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase and galactosylceramide by beta-galactosylceramidase. Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate. Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A, GM1 gangliosides by beta-galactosidase and globotriaosylceramide by alpha-galactosidase A. Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases. Saposin-D is a specific sphingomyelin phosphodiesterase activator. Prosaposin: Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling. Saposins are specific low-molecular mass non-enzymic proteins, they participate in the lysosomal degradation of sphingolipids, which takes place by the sequential action of specific hydrolases.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Proactivator polypeptide
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT
Research Area Signal Transduction
Source Yeast
Gene Names PSAP
Protein Names Recommended name: Proactivator polypeptide Cleaved into the following 5 chains: 1. Saposin-A Alternative name(s): Protein A Saposin-B-Val Saposin-B Alternative name(s): Cerebroside sulfate activator Short name= CSA
Expression Region 311-391aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 11.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.; FUNCTION
Involvement in disease Combined saposin deficiency (CSAPD); Leukodystrophy metachromatic due to saposin-B deficiency (MLD-SAPB); Gaucher disease, atypical, due to saposin C deficiency (AGD); Krabbe disease, atypical, due to saposin A deficiency (AKRD)
Subcellular Location Lysosome, SUBCELLULAR LOCATION: Prosaposin: Secreted
Database Links

HGNC: 9498

OMIM: 176801

KEGG: hsa:5660

STRING: 9606.ENSP00000378394

UniGene: Hs.523004

Related Products

PSAP Antibodies

PSAP Antibodies for Human

PSAP Antibodies for Homo sapiens (Human)

PSAP Proteins

PSAP Proteins for Homo sapiens (Human)

PSAP ELISA Kit

PSAP ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.