Recombinant Human Proactivator polypeptide (PSAP)

Code CSB-BP018836HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP018836HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP018836HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
A1 activator; Cerebroside sulfate activator; Co-beta-glucosidase; Component C; CSAct; Dispersin; GLBA; Glucosylceramidase activator; Proactivator polypeptide; Proactivator polypeptide precursor; Prosaposin (sphingolipid activator protein 1); prosaposin (variant Gaucher disease and variant metachromatic leukodystrophy); Prosaposin; Protein A; Protein C; PSAP; SAP 1; SAP 2; SAP-1; SAP-2; SAP_HUMAN; SAP1; Saposin A; Saposin B; Saposin B Val; Saposin C; Saposin D; Saposin-D; Saposins; Sgp1; Sphingolipid activator protein 1; Sphingolipid activator protein 2; Sulfated glycoprotein 1; Sulfatide/GM1 activator
Species
Homo sapiens (Human)
Expression Region
311-391
Target Protein Sequence
SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGT
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Saposin-A and saposin-C stimulate the hydrolysis of glucosylceramide by beta-glucosylceramidase (EC 3.2.1.45) and galactosylceramide by beta-galactosylceramidase (EC 3.2.1.46). Saposin-C apparently acts by combining with the enzyme and acidic lipid to form an activated complex, rather than by solubilizing the substrate.; Saposin-B stimulates the hydrolysis of galacto-cerebroside sulfate by arylsulfatase A (EC 3.1.6.8), GM1 gangliosides by beta-galactosidase (EC 3.2.1.23) and globotriaosylceramide by alpha-galactosidase A (EC 3.2.1.22). Saposin-B forms a solubilizing complex with the substrates of the sphingolipid hydrolases.; Saposin-D is a specific sphingomyelin phosphodiesterase activator (EC 3.1.4.12).; Behaves as a myelinotrophic and neurotrophic factor, these effects are mediated by its G-protein-coupled receptors, GPR37 and GPR37L1, undergoing ligand-mediated internalization followed by ERK phosphorylation signaling.; Saposins are specific low-molecular mass non-enzymic proteins, they participate in the lysosomal degradation of sphingolipids, which takes place by the sequential action of specific hydrolases.
Gene References into Functions
  1. Accumulating evidence suggests that PGRN is essential for proper lysosomal function, but the precise mechanisms involved are not known. Here, we show that PGRN facilitates neuronal uptake and lysosomal delivery of prosaposin (PSAP), the precursor of saposin peptides that are essential for lysosomal glycosphingolipid degradation. PMID: 28541286
  2. Both PSAP reduction and overexpression lead to significantly elevated extracellular progranulin (PGRN) levels. Intriguingly, PSAP knockdown increases PGRN monomers, whereas PSAP overexpression increases PGRN oligomers, partly through a protein-protein interaction. PMID: 27356620
  3. Study demonstrated that the binding of CST3 and PSAP decreased the inhibitory effects of CST3 on proteinase in vitro. The co-localization of both proteins was detected in cultured cells and in Bunina body-containing motor neurons from patients with amyotrophic lateral sclerosis, suggesting that they might be involved in the process of Bunina body formation. PMID: 29249381
  4. This report documents the successful use of plasma lysoSLs profiling in the PSAP deficiency diagnosis, as a reliable and informative tool to obtain a preliminary information in infantile cases with complex traits displaying severe neurological signs and visceral involvement. PMID: 26831127
  5. an extensive review of all the PSAP-causative variants published in the literature to date, accounting for a total of 10 PSAP allele types (review) PMID: 26462614
  6. Our findings suggest a novel pharmacological approach to Sap C deficiency directed to treat major secondary pathological aspects in this disorder. PMID: 25926625
  7. PSAP is a secreted biomarker. PMID: 26341737
  8. Data suggested that the abundance of Psap in sperm sample may be a sensitive endpoint to predict PCB exposure. PMID: 26045750
  9. Prosaposin facilitates sortilin-independent lysosomal trafficking of progranulin. PMID: 26370502
  10. findings support a lung metastasis-promoting function of the miR-23b/27b/24 cluster of miRNAs, which functions in part through the direct inhibition of PSAP in breast cancer PMID: 24966325
  11. Of the 2575 proteins identified, proteins upregulated in gallbladder cancer included several lysosomal proteins such as prosaposin, cathepsin Z and cathepsin H. PMID: 24657443
  12. Saposin C protects glucocerebrosidase against alpha-synuclein inhibition. PMID: 24070323
  13. Urine of patients with early prostate cancer contains lower levels of light chain fragments of inter-alpha-trypsin inhibitor and prosaposin fragment or saposin B. PMID: 23417432
  14. These findings suggested that prosaposin might enhance estrogen receptor alpha-mediated signaling axis and play a role in breast cancer development and progression. PMID: 22738294
  15. PSAP is a novel TFPI-2-interacting protein and that the binding sites are the KD2 of TFPI-2 and the C-terminus of PSAP. PMID: 21943334
  16. novel esophageal squamous cell carcinoma marker PSAP was identified by mass spectrometry and immunohistochemical analysis PMID: 21743296
  17. PSAP is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells. PMID: 21555518
  18. saposin C caused stimulation of androgen receptor expression and activity by associations with Src kinases PMID: 21328455
  19. Saposin B(Sap B) is not a limiting factor of the coupled Sap B-arylsulfatase A reaction in mouse kidney cells even if sulfatide has accumulated to unphysiologically high levels PMID: 19224915
  20. The biological properties of cells from four recently described Gaucher disease patients carrying mutations in the Sap C domain of the PSAP gene have been characterized. PMID: 20484222
  21. PSAP is involved in prostate cancer invasion. PMID: 20132547
  22. reconstruction of the order of internal duplications that gave rise to the four saposins by using phylogenetic tools PMID: 11734895
  23. procathepsin D interacts with prosaposin in human breast and ovarian cancer cells. PMID: 12083803
  24. crystal structure reveals a dimeric shell for lipid binding PMID: 12518053
  25. data indicate that saposin C is required for acid beta-glucosidase resistance to proteolytic degradation in the cell PMID: 12813057
  26. The structure of saposin C compared to other saposin-fold family members provides an explanation for function variability of this protein family. PMID: 14674747
  27. model proposed in which saposin C exposes lipid antigens from intralysosomal membranes for loading onto CD1b PMID: 14716313
  28. There might be a potential pleuripotent regulatory function for prosaposin in prostate cancer. PMID: 15305334
  29. Amplification and overexpression of PSAP was studied in prostatic neoplasms. PMID: 16080200
  30. determination of crystal structure of human saposins A and C to 2.0 Angstroms and 2.4 Angstroms, respectively and both reveal the compact, monomeric saposin fold PMID: 16823039
  31. FSAP (Factor VII-activating protease) can cleave and inactivate PDGF-BB (platelet-derived growth factor-BB) and thereby inhibits VSMC (vascular smooth-muscle cell) proliferation. PMID: 17300216
  32. saposin B may facilitate lipid binding to CD1d molecules throughout the endocytic pathway PMID: 17372201
  33. an unglycosylated Sap-B variant, Asn215His, which causes a fatal sphingolipid storage disease, lost the ability to extract membrane lipids at acidic pH in the presence of BMP PMID: 17561962
  34. Expression of saposin C-originated saposin C may upregulate AR gene expression and activate the androgen receptor transcriptional function in an androgen-independent manner in prostate cancer cells. PMID: 17712477
  35. These data for the first time demonstrate that not only saposin C or PSAP regulates AR expression/activity, but also function as an androgen-regulated gene in prostate stromal cells. PMID: 18481277
  36. findings point to the role of lipid rafts in the prosaposin-triggered signalling pathway, thus supporting a role for this factor as a new component of the multimolecular signalling complex involved in the neurotrophic response. PMID: 18761669
  37. two new patients with PSAP gene defects; one, with pSap-d, who had a severe neurovisceral dystrophy and died as a neonate, and the other with SapB-d, who presented with a metachromatic leukodystrophy-like disorder but had normal arylsulfatase activity PMID: 19267410
  38. Report the up-regulation of prosaposin in the senescent fibroblasts and endothelial cells. PMID: 19471889
  39. Prosaposin functions in a paracrine and endocrine fashion by stimulating the expression of thrombospondin-1 (Tsp-1) in fibroblasts present in both primary tumors and distant organs, doing so in a p53-dependent manner. PMID: 19581582
  40. Saposin C or its precursor (PSAP) function as an androgen-agonist and upregulate androgen receptor and prostate-specific antigen expression/activity in androgen-responsive prostate cancer cells LNCaP, TRAMP-C1 and -C2., and CWR 22RV1. PMID: 17044040
  41. Prosaposin is an androgen-target gene and its expression in androgen-responsive prostate cancer cells can be upregulated by male hormones. PMID: 17171640
  42. Cloning of prosaposin gene from androgen-independent (AI) prostate cancer (PCa) cells and it genomic amplification in human metastatic AI PCa cell lines and punch biopsy samples of prostate cancer xenografts and lymph node metastases. PMID: 16080200
  43. Saposin C stimulates prostate cancer and stromal cells growth and invasion and uPA/uPAR expression, and activates p42/44 and SAPK/JNK signaling pathways of MAPK. PMID: 15897971
  44. Prosaposin and/or saposin C via modulation of caspases expression/activity and/or PI3K/Akt signaling pathway act as a survival and anti-apoptotic factor for prostate cancer cells. PMID: 15548330

Show More

Hide All

Involvement in disease
Combined saposin deficiency (CSAPD); Leukodystrophy metachromatic due to saposin-B deficiency (MLD-SAPB); Gaucher disease, atypical, due to saposin C deficiency (AGD); Krabbe disease, atypical, due to saposin A deficiency (AKRD)
Subcellular Location
Lysosome.; [Prosaposin]: Secreted.
Database Links

HGNC: 9498

OMIM: 176801

KEGG: hsa:5660

STRING: 9606.ENSP00000378394

UniGene: Hs.523004

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1