Recombinant Human Protein FAM3B (FAM3B)

In Stock
Code CSB-EP008227HU
Abbreviation Recombinant Human FAM3B protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-235aa
Target Protein Sequence
ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
Gene References into Functions
  1. Taken together, by activating pro-survival mechanisms FAM3B overexpression contributes to increased resistance to cell death and tumor growth in nude mice, highlighting a putative role for this cytokine in prostate cancer progression. PMID: 29357840
  2. FAM3B overexpression contributes to increased resistance to cell death and tumor growth in nude mice. PMID: 29357840
  3. Data suggest that serum PANDER levels are significantly elevated in patients with long-standing type 2 diabetes as compared to patients with recently diagnosed type 2 diabetes and control subjects; serum PANDER levels vary according to degree of insulin resistance. PMID: 28161382
  4. Circulating level of pancreatic-derived factor (PANDER) in relation to the accumulation in metabolic syndrome suggested that persons with elevated levels of PANDER were associated with an increased risk of metabolic syndrome. PMID: 27181109
  5. in-vitro and in-vivo glucose is a potent stimulator of the PANDER promoter within the liver and this response may be facilitated by ChREBP. PMID: 26123584
  6. beta-cell-secreted PANDER regulated the hepatic insulin and lipogenenic signaling and impact overall glycemia. PMID: 24468680
  7. It is an important regulator of glucose and lipid metabolism and plays a role in the pathogenesis of nonalcoholic fatty liver disease.(review) PMID: 23855304
  8. our studies demonstrated that silencing FAM3B promoted p53 phosphorylation and induced p53 accumulation by decreasing Mdm2 expression, which resulted in apoptotic cell death. PMID: 23246487
  9. These results suggest that FAM3B-258 promotes colon cancer cell invasion and metastasis through upregulation of Slug. PMID: 23059759
  10. Localized to the islets of Langerhans. PMID: 12160727
  11. Helices B and C and the second disulfide bond of PANDER are essential for PANDER-induced beta-cell death. PMID: 16114871
  12. PANDER is secreted from 2 types of pancreatic cells, glucose stimulates its secretion in beta cell and primary islets but not in alpha-cells, it is likely cosecreted with insulin, and structure and conformation is vital for PANDER secretion. PMID: 16249448

Show More

Hide All

Subcellular Location
Secreted. Note=Present in insulin secretory granules and likely cosecreted with insulin. Localized in discrete vesicular and perinuclear structure.
Protein Families
FAM3 family
Tissue Specificity
Highly expressed in the pancreas. Also found in the colon, kidney, prostate, small intestine and testis.
Database Links

HGNC: 1253

OMIM: 608617

KEGG: hsa:54097

STRING: 9606.ENSP00000350673

UniGene: Hs.473877

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*