Recombinant Human Protein LDOC1 (LDOC1)

Code CSB-EP012851HU
Abbreviation Recombinant Human LDOC1 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
LDOC1
Uniprot No.
Research Area
Cancer
Alternative Names
Leucine zipper protein down-regulated in cancer cells
Source
E.coli
Expression Region
1-146aa
Target Protein Sequence
MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May have an important role in the development and/or progression of some cancers.
Gene References into Functions
  1. that epigenetic silencing of LDOC1 in high-risk Group A ependymoma regulates tumor biology and drives inflammatory immune phenotype PMID: 28510691
  2. GNL3L-LDOC1 interplay regulates cell proliferation through the modulation of NF-kappaB pathway during tumorigenesis. PMID: 27764577
  3. These finding of this study suggested that the hypothesize that LDOC1 gene upregulation may play a role in the spermatogenesis derangement observed in patients with Klinefelter Syndrome. PMID: 27076087
  4. data show that LDOC1 is a tumor suppressor in osteosarcoma, and that it regulates metastasis of osteosarcoma cells. Furthermore, LDOC1 might be a valuable prognostic marker in osteosarcomas. PMID: 28240050
  5. Cigarette smoke-induced promoter methylation may contribute to LDOC1 downregulation, thereby conferring oncogenic features to oral cells. PMID: 26317789
  6. LDOC1 inhibits proliferation and promotes apoptosis by repressing NF-kappaB activation in papillary thyroid carcinoma PMID: 26637328
  7. It has potential roles in apoptosis of well differentiated carcinoma without metastases and in neurodegeneration of Alzheimer's disease. PMID: 23775301
  8. Silencing of LDOC1 is a frequent event in cervical cancer and may be of interest as a molecular marker in cervical cancer. PMID: 24125169
  9. Silencing of BEX1 and LDOC1 by promoter hypermethylation might represent a critical event in the molecular pathogenesis of oral squamous cell carcinoma (OSCC) and the male predominance of OSCC occurrence. PMID: 23362108
  10. Letter/Case Report: LDOC1/PARP1 are down-regulated in melanoma with repeated in-transit metastases. PMID: 21986234
  11. The aim of this study was to evaluate the possible differential expression of LDOC1 mRNA in leucocytes of peripheral blood of Down's syndrome subjects. compared with the normal population. PMID: 22546831
  12. Over expression of LDOC1 may explain the clinical manifestation found in patients with cryptochidism and Digeorge anomaly. PMID: 21547351
  13. LDOC1 is dramatically down-regulated in mutated chronic lymphocytic leukemia cases compared with unmutated cases, and have identified a new splice variant, LDOC1S PMID: 21310924
  14. These observations suggest that LDOC1 is a novel regulator of NF-kappaB that can affect the PMA or TNF-alpha-mediated pathway to apoptosis through inhibition of NF-kappaB activation in BxPC3 pancreatic cancer cells. PMID: 12712434
  15. MZF-1 was revealed to interact with LDOC1 and enhance the activity of LDOC1 for inducing apoptosis PMID: 15670815

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
LDOC1 family
Tissue Specificity
Ubiquitously expressed with high levels in brain ant thyroid and low expression in placenta, liver and leukocytes. Expressed as well in six of the seven human breast cancer cell lines examined.
Database Links

HGNC: 6548

OMIM: 300402

KEGG: hsa:23641

STRING: 9606.ENSP00000359557

UniGene: Hs.45231

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*