Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
18A2; 42A; calcium Placental protein; Calvasculin; CAPL; Fibroblast specific protein 1 (FSP1); Fibroblast specific protein 1; Fibroblast specific protein; FSP1; Leukemia multidrug resistance associated protein; Malignant transformation suppression 1 (MTS1); Malignant transformation suppression 1; Metastasin; MTS1; OTTHUMP00000015467; OTTHUMP00000015468; P9KA; PEL98; Placental calcium-binding protein; Protein Mts1; Protein S100 A4; Protein S100-A4; S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); S100 calcium binding protein A4; S100 calcium-binding protein A4; S100a4; S10A4_HUMAN
Species
Homo sapiens (Human)
Expression Region
2-101aa
Target Protein Sequence
ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Enhance your cardiovascular research with our premium-quality Recombinant Human S100A4 protein, also known as Calvasculin, Metastasin, Placental calcium-binding protein, Protein Mts1, and S100 calcium-binding protein A4. S100A4 is involved in a variety of cellular processes, including motility, proliferation, and angiogenesis, and plays a significant role in the progression of atherosclerosis and other cardiovascular diseases, making it an important target for research and therapeutic intervention.
Our Recombinant Human S100A4 protein is produced using a reliable E.coli expression system, ensuring a consistent and high-quality source for your research needs. The full-length mature protein sequence (2-101aa) is N-terminal 6xHis-SUMO-tagged to facilitate efficient purification while maintaining native conformation and activity. With a purity greater than 90% as determined by SDS-PAGE, our S100A4 protein guarantees dependable and reproducible results in various experimental setups. Choose between liquid and lyophilized powder forms to best suit your research requirements, and take advantage of our exceptional-quality Recombinant Human S100A4 protein in your cardiovascular research.