Recombinant Human Protein arginine N-methyltransferase 8 (PRMT8), partial

Code CSB-YP889086HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP889086HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP889086HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP889086HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP889086HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PRMT8
Uniprot No.
Alternative Names
ANM8_HUMAN; Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4 ; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HMT1 hnRNP methyltransferase like 3; HMT1 hnRNP methyltransferase like 4; HRMT1 L3; HRMT1 L4; HRMT1L 3; HRMT1L 4; HRMT1L3; HRMT1L4; prmt8; Protein arginine N methyltransferase 4; Protein arginine N methyltransferase 8; Protein arginine N-methyltransferase 8
Species
Homo sapiens (Human)
Expression Region
61-394
Target Protein Sequence
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
S-adenosyl-L-methionine-dependent and membrane-associated arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA) in proteins such as NIFK, myelin basic protein, histone H4, H2A and H2A/H2B dimer. Able to mono- and dimethylate EWS protein; however its precise role toward EWS remains unclear as it still interacts with fully methylated EWS.
Gene References into Functions
  1. PRMT8 in human embryonic stem cells plays an important role not only in maintaining pluripotency but also in controlling mesodermal differentiation. PMID: 28543863
  2. Biochemical, biophysical and mutagenesis experiments demonstrated that hPRMT8 forms an octamer in solution. PMID: 26876602
  3. Mutational defects in PRMT8 is not the cause of frontotemporal lobar degeneration. PMID: 23635657
  4. automethylation of the N terminus likely regulates PRMT8 activity by decreasing the affinity of the enzyme for AdoMet PMID: 23946480
  5. wild type FUS (FUS-WT) specifically interacts with protein arginine methyltransferases 1 and 8 (PRMT1 and PRMT8) and undergoes asymmetric dimethylation PMID: 23620769
  6. PRMT8 is an active arginine methyltransferase that is membrane-associated and tissue-specific PMID: 16051612
  7. PRMT8 N-terminal domain may function as an autoregulator that may be displaced by interaction with one or more physiological inducers. PMID: 17925405
  8. The interaction between PRMT8 and the EWS protein was charcterized. PMID: 18320585
  9. EWS is a substrate for PRMT8, as efficient as for PRMT1 PMID: 18698489

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Protein arginine N-methyltransferase family, PRMT8 subfamily
Tissue Specificity
Brain-specific.
Database Links

HGNC: 5188

OMIM: 610086

KEGG: hsa:56341

STRING: 9606.ENSP00000372067

UniGene: Hs.504530

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1