Recombinant Human Protein atonal homolog 1 (ATOH1)

Code CSB-EP846107HU
Abbreviation Recombinant Human ATOH1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
ATOH1
Uniprot No.
Research Area
Developmental Biology
Alternative Names
ATH1; ATOH1; ATOH1_HUMAN; Atonal homolog 1 (Drosophila); Atonal homolog 1; bHLHa14; Class A basic helix-loop-helix protein 14; hATH1; Helix loop helix protein hATH 1; Helix-loop-helix protein hATH-1; MATH 1; MATH1; Protein atonal homolog 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-354aa
Target Protein Sequence
MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVDGRGELVRRSSGGASSSKSPGPVKVREQLCKLKGGVVVDELGCSRQRAPSSKQVNGVQKQRRLAANARERRRMHGLNHAFDQLRNVIPSFNNDKKLSKYETLQMAQIYINALSELLQTPSGGEQPPPPPASCKSDHHHLRTAASYEGGAGNATAAGAQQASGGSQRPTPPGSCRTRFSAPASAGGYSVQLDALHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSDEAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Gene References into Functions
  1. Our results suggest that KN promotes goblet cell differentiation by regulating Wnt, Notch, and AhR signals and expression of Hes1 and Hath1. PMID: 29436668
  2. The authors discovered tyrosine 78 of Atoh1 is phosphorylated by a Jak2-mediated pathway only in tumor-initiating cells and in human Sonic Hedgehog-type medulloblastoma. PMID: 29168692
  3. ATOH1 expression was detected consistently in recurrent and metastatic SHH medulloblastoma. Chromatin immunoprecipitation sequencing and gene expression profiling identified candidate ATOH1 targets in tumor cells involved in development and tumorigenesis. PMID: 28490517
  4. These data indicate that the regulation of Atoh1 by the ubiquitin proteasome pathway is necessary for hair cell fate determination and survival. PMID: 27542412
  5. ATOH1 is increased in advanced Merkel cell carcinoma (MCC) indicating that ATOH1 is involved in MCC progression. PMID: 27624714
  6. Study provides evidence that Sox2 expression is required for the late stages of progenitor cell differentiation to hair cells and stimulates Atoh1 expression through a concentration dependent molecular interaction with the 3' enhancer of Atoh1. PMID: 26988140
  7. mutation not found in group of children with sensorineural hearing loss PMID: 26634621
  8. Downregulation of Hath1 expression promoted the proliferation and reduced the apoptosis of KUMA5 squamous cell carcinoma cells. PMID: 26648003
  9. ATOH1 can induce the differentiation of gastric cancer stem cells. PMID: 25950549
  10. ATOH1 acts in concert with other transcription factors to directly regulate the cochlear hair cell phenotype. PMID: 25015561
  11. Testosterone-bovine serum albumin and Math1 treatment could promote an increase in hair-cell like cells in the lesser epithelial ridge through proliferation and transdifferentiation. PMID: 25957791
  12. Atoh1 epigenetic regulation guides hair cell development in the mammalian cochlea PMID: 26487780
  13. Atoh1 protein stabilization induced both a cancer stem cell phenotype and a mucinous phenotype, resulting in the acquisition of chemoresistance in colorectal cancer PMID: 26017781
  14. Chicken Atoh1 might have intrinsic functional differences to mammalian Atoh1. PMID: 25412697
  15. In this review, expression of the Atoh1 gene in supporting cells, results in their transformation into immature hair cells. PMID: 25648190
  16. Data suggest that Atoh1 high expression correlates with a good prognosis and it may serve as a favorable prognostic factor for GIST. PMID: 25400808
  17. Expression of Hath1, Muc2, cyclin D1 and p27 in the xenograft tumors was also detected. PMID: 23464457
  18. Atoh1 transfection drives highly efficient differentiation of human pluripotent stem cells into dopaminergic neurons. PMID: 24904172
  19. cotransfection of Pax2 and Math1 strongly stimulates in situ hair cell regeneration in neomycin-damaged cochlear explants. PMID: 24141260
  20. The transcription factor Atoh1, which is both necessary and sufficient for hair cell development. PMID: 23724999
  21. the Atoh1 protein regulates malignant potential rather than the differentiation phenotype of mucinous colon cancer (MC), suggesting the mechanism by which MC and signet ring cell carcinoma are more malignant than non-mucinous adenocarcinoma. PMID: 23333391
  22. Nuclear expression of Atoh1 was inversely correlated with the differentiation and primary tumor stage of lung cancers and also the downregulation of the Wnt pathway. PMID: 23030416
  23. H. pylori up-regulates Hath1 expression through inducing the release of IL-8 in MKN28 cells. PMID: 22786753
  24. Transfection of hATOH1 in combination with hTCF3 or hGATA3 induced 2-3X more Pou4f3/GFP cells, and similarly enhanced Pou4f3/GFP and myosin VIIa double-positive cells, when compared to hATOH1 alone PMID: 22985730
  25. involved in differentiation of neurons, secretory cells in the gut, and mechanoreceptors including auditory hair cells [review] PMID: 22370966
  26. In vivo conversion of pillar cells and Deiters' cells into immature auditory hair cells by Atoh1 is age dependent and resembles normal auditory hair cell development. PMID: 22573682
  27. Atoh1 activates cell proliferation within the normally postmitotic cochlear epithelium. PMID: 22573692
  28. Math1/Atoh1 ectopic expression significantly reduced cell proliferation and altered cell morphology in Barrett esophagus PMID: 22147253
  29. Longitudinal cell formation in the small intestine was regulated by the colocalization of Hath1 and Klf4 that converted Paneth cell differentiation into goblet cell differentiation. PMID: 21125297
  30. Atonal homolog 1 is required for growth and differentiation effects of notch/gamma-secretase inhibitors on normal and cancerous intestinal epithelial cells. PMID: 20621629
  31. we investigated by immunohistochemistry the expression of Hath1 in 63 neuroendocrine tumors PMID: 19924642
  32. Maps to 10q21-22. Candidate gene for optic nerve aplasia and related syndromes. PMID: 11889557
  33. Proneural and proneuroendocrine transcription factor expression in cutaneous mechanoreceptor (Merkel) cells and Merkel cell carcinoma PMID: 12209986
  34. Hath1 may regulate the expression of MUC2, a mucin secreted by goblet cells, and Hath1 may also be a novel factor normally repressed as a consequence of activation of the Wnt signaling pathway [review] PMID: 16382053
  35. Hath1 is one of the transcriptional regulators for MUC6 and MUC5AC in gastric cancer cells. PMID: 16647036
  36. Based on these results, we hypothesize that Cdx2 is involved in activating Math1 expression in intestinal epithelial cells. PMID: 16831200
  37. HATH1 is an important factor in the up-regulation of MUC2 expression that occurs in mucinous cancers and signet ring carcinomas. PMID: 17000673
  38. GSK3beta-dependent protein degradation was switched between Hath1 and beta-catenin by Wnt signaling, leading to the dramatic alteration of cell status between proliferation and differentiation in colon cancer PMID: 17241872
  39. In the chimeric environment, genotypically wild-type cells that possess Math1 have the competence to differentiate into hair cells by providing appropriate environmental interactions. PMID: 17397818
  40. Patients with ATOH1-expressing adenocarcinomas might have a worse prognosis. PMID: 17549667
  41. ATOH1 activates hairy and enhancer of split 6 transcription through binding to three clustered E boxes of its promoter PMID: 17826772
  42. Hath1 protein degradation may be required for maintaining the undifferentiated state of colon cancers, and that GSK3 inhibitors have potential for use in cancer therapy. PMID: 18275842
  43. Our data indicate that ATOH1 may be an early target for oncogenic mutations in tissues where it instructs cellular differentiation. PMID: 19243219
  44. Adult Atoh1-conditional knock-out mice are behaviorally deaf, have diminished auditory brainstem responses and disrupted auditory nuclei morphology. PMID: 19741118

Show More

Hide All

Subcellular Location
Nucleus.
Database Links

HGNC: 797

OMIM: 601461

KEGG: hsa:474

STRING: 9606.ENSP00000302216

UniGene: Hs.532680

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*