Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
AI413481; Delta like 2 homolog; Delta like protein 2; delta-like 2 homolog (Drosophila); DLK 2; DLK-2; Dlk2; DLK2_HUMAN; EGF like domain containing protein 9; EGF like domain multiple 9; EGF-like protein 9; EGFL 9; EGFL9; Epidermal growth factor-like protein 9; MGC111055; MGC2487; Multiple EGF like domain protein 9; OTTHUMP00000016449; OTTHUMP00000016451; Protein delta homolog 2
Species
Homo sapiens (Human)
Expression Region
27-306aa
Target Protein Sequence
DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human DLK2 contains amino acids 27-306. This DLK2 protein is theoretically predicted to have a molecular weight of 56.8 kDa. This DLK2 recombinant protein is manufactured in e.coli. Fusion of the N-terminal GST tag into the DLK2 encoding gene fragment was conducted, allowing for easier detection and purification of the DLK2 protein in subsequent stages.
Human protein delta Homolog 2 (DLK2) is a transmembrane protein involved in various developmental processes. It is mainly involved in the regulation of cell differentiation, particularly in adipogenesis and osteogenesis. Investigation of DLK2 provides insights into developmental processes, stem cell biology, and tissue regeneration, offering potential applications in regenerative medicine, tissue engineering, and understanding the molecular mechanisms governing cell fate determination in various tissues. In developmental biology, DLK2 plays a role in tissue patterning and organogenesis. In stem cell research, DLK2 is implicated in the maintenance of pluripotency and differentiation potential. Additionally, DLK2 is associated with the Notch signaling pathway, influencing cell fate decisions.
