Recombinant Human Protein delta homolog 2 (DLK2), partial

In Stock
Code CSB-EP751023HU
Abbreviation Recombinant Human DLK2 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DLK2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
AI413481; Delta like 2 homolog; Delta like protein 2; delta-like 2 homolog (Drosophila); DLK 2; DLK-2; Dlk2; DLK2_HUMAN; EGF like domain containing protein 9; EGF like domain multiple 9; EGF-like protein 9; EGFL 9; EGFL9; Epidermal growth factor-like protein 9; MGC111055; MGC2487; Multiple EGF like domain protein 9; OTTHUMP00000016449; OTTHUMP00000016451; Protein delta homolog 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-306aa
Target Protein Sequence
DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.8kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human DLK2 contains amino acids 27-306. This DLK2 protein is theoretically predicted to have a molecular weight of 56.8 kDa. This DLK2 recombinant protein is manufactured in e.coli. Fusion of the N-terminal GST tag into the DLK2 encoding gene fragment was conducted, allowing for easier detection and purification of the DLK2 protein in subsequent stages.

Human protein delta Homolog 2 (DLK2) is a transmembrane protein involved in various developmental processes. It is mainly involved in the regulation of cell differentiation, particularly in adipogenesis and osteogenesis. Investigation of DLK2 provides insights into developmental processes, stem cell biology, and tissue regeneration, offering potential applications in regenerative medicine, tissue engineering, and understanding the molecular mechanisms governing cell fate determination in various tissues. In developmental biology, DLK2 plays a role in tissue patterning and organogenesis. In stem cell research, DLK2 is implicated in the maintenance of pluripotency and differentiation potential. Additionally, DLK2 is associated with the Notch signaling pathway, influencing cell fate decisions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates adipogenesis.
Gene References into Functions
  1. Studies in mouse showed that dlk2, highly homologous to dlk1 (also known as pref-1, and FA-1) appears to modulate adipogenesis in vitro in an opposite way to that of dlk1. PMID: 17320102
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 21113

KEGG: hsa:65989

STRING: 9606.ENSP00000349893

UniGene: Hs.337251

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*