Recombinant Human Protein phosphatase 1B (PPM1B)

In Stock
Code CSB-EP018490HU
Abbreviation Recombinant Human PPM1B protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
MGC21657; OTTHUMP00000158953; OTTHUMP00000158954; OTTHUMP00000158955; OTTHUMP00000202394; OTTHUMP00000202395; OTTHUMP00000202399; PP2C beta; PP2C beta X; PP2C-beta; PP2CB; PP2Cbeta; PPC2BETAX; PPM 1B; Ppm1b; PPM1B_HUMAN; Protein phosphatase 1B (formerly 2C) magnesium dependent beta isoform; Protein phosphatase 1B; Protein phosphatase 1B magnesium dependent beta isoform; Protein phosphatase 2C beta isoform; Protein phosphatase 2C isoform beta; Protein phosphatase 2C like protein; Protein phosphatase, Mg2+/Mn2+ dependent, 1B
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-192aa
Target Protein Sequence
MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.6kDa
Protein Length
Full Length of Isoform Beta-X
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.
Gene References into Functions
  1. Results indicate that protein phosphatase 1B (PPM1B) negatively regulates cancer cell motility and invasiveness through dephosphorylating Rho guanine nucleotide dissociation inhibitor 1 (RhoGDI1). PMID: 29307615
  2. PPM1B plays a negative role in the activation of the p38-RB1-E2F1 pathway and that targeting PPM1B could be useful in certain types of cancer by stimulating chemotherapy-induced cell death. PMID: 29654756
  3. This study has identified PPM1B and miR-186 as potential diagnostic markers in bladder cancer. Promotion of PPM1B and suppression of miR-186 may offer effective therapeutic strategies in the treatment of bladder cancer. PMID: 26494000
  4. PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing. PMID: 25631048
  5. Results identify PPM1B as a critical regulator of both p38 MAPK-dependent and independent senescence pathways during normal cellular aging process. PMID: 24674756
  6. Cadmium reversed PPM1A-induced cell cycle arrest and cadmium insensitive PPM1A mutant rescued cadmium induced cell death. PMID: 23903585
  7. Protein kinase A activates NF-kappaB-mediated transcription by destabilization of PP2Cbeta. PMID: 23756813
  8. PPM1B functions as a TBK1 phosphatase dephosphorylates TBK1 at serine 172 and terminates TBK1-mediated IRF3 activation and IFNbeta gene expression. PMID: 22750291
  9. Studies show that Ppm1b plays a multilayered role in regulating the availability and optimal activity of the EKLF protein in erythroid cells. PMID: 22393050
  10. results implicate a novel and important role for PP2Cbetal in regulating hPXR activity and CYP3A4 expression by inhibiting or desensitizing signaling pathways that negatively regulate the function of pregnane X receptor in liver cells PMID: 20538721
  11. PP2Cbeta down-regulates cytokine-induced NF-kappaB activation by altering IKK activity. PMID: 14585847
  12. Protein phosphatase 1B is mediated dephosphorylation and inactivation of I-kappa B kinase as well as the termination of the Tumor Necrosis Factor-alpha-induced NF-kappaappaB activation. PMID: 18930133

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol. Membrane; Lipid-anchor.
Protein Families
PP2C family
Tissue Specificity
Highly expressed in heart and skeletal muscle.
Database Links

HGNC: 9276

OMIM: 603770

KEGG: hsa:5495

STRING: 9606.ENSP00000282412

UniGene: Hs.416769

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*