Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PPM1B

Uniprot No.

O75688

Research Area

Signal Transduction

Alternative Names

MGC21657; OTTHUMP00000158953; OTTHUMP00000158954; OTTHUMP00000158955; OTTHUMP00000202394; OTTHUMP00000202395; OTTHUMP00000202399; PP2C beta; PP2C beta X; PP2C-beta; PP2CB; PP2Cbeta; PPC2BETAX; PPM 1B; Ppm1b; PPM1B_HUMAN; Protein phosphatase 1B (formerly 2C) magnesium dependent beta isoform; Protein phosphatase 1B; Protein phosphatase 1B magnesium dependent beta isoform; Protein phosphatase 2C beta isoform; Protein phosphatase 2C isoform beta; Protein phosphatase 2C like protein; Protein phosphatase, Mg2+/Mn2+ dependent, 1B

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-192aa

Target Protein Sequence

MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.6kDa

Protein Length

Full Length of Isoform Beta-X

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.

Gene References into Functions

Results indicate that protein phosphatase 1B (PPM1B) negatively regulates cancer cell motility and invasiveness through dephosphorylating Rho guanine nucleotide dissociation inhibitor 1 (RhoGDI1). PMID: 29307615
PPM1B plays a negative role in the activation of the p38-RB1-E2F1 pathway and that targeting PPM1B could be useful in certain types of cancer by stimulating chemotherapy-induced cell death. PMID: 29654756
This study has identified PPM1B and miR-186 as potential diagnostic markers in bladder cancer. Promotion of PPM1B and suppression of miR-186 may offer effective therapeutic strategies in the treatment of bladder cancer. PMID: 26494000
PPM1B interacts with Groucho 4 and is localized to DNA in a Groucho-dependent manner, and phosphatase activity is required for transcriptional silencing. PMID: 25631048
Results identify PPM1B as a critical regulator of both p38 MAPK-dependent and independent senescence pathways during normal cellular aging process. PMID: 24674756
Cadmium reversed PPM1A-induced cell cycle arrest and cadmium insensitive PPM1A mutant rescued cadmium induced cell death. PMID: 23903585
Protein kinase A activates NF-kappaB-mediated transcription by destabilization of PP2Cbeta. PMID: 23756813
PPM1B functions as a TBK1 phosphatase dephosphorylates TBK1 at serine 172 and terminates TBK1-mediated IRF3 activation and IFNbeta gene expression. PMID: 22750291
Studies show that Ppm1b plays a multilayered role in regulating the availability and optimal activity of the EKLF protein in erythroid cells. PMID: 22393050
results implicate a novel and important role for PP2Cbetal in regulating hPXR activity and CYP3A4 expression by inhibiting or desensitizing signaling pathways that negatively regulate the function of pregnane X receptor in liver cells PMID: 20538721
PP2Cbeta down-regulates cytokine-induced NF-kappaB activation by altering IKK activity. PMID: 14585847
Protein phosphatase 1B is mediated dephosphorylation and inactivation of I-kappa B kinase as well as the termination of the Tumor Necrosis Factor-alpha-induced NF-kappaappaB activation. PMID: 18930133

Hide All

Subcellular Location

Cytoplasm, cytosol. Membrane; Lipid-anchor.

Protein Families

PP2C family

Tissue Specificity

Highly expressed in heart and skeletal muscle.

Database Links

HGNC: 9276

OMIM: 603770

KEGG: hsa:5495

STRING: 9606.ENSP00000282412

UniGene: Hs.416769

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP018490HU
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Protein phosphatase 1B (PPM1B)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage