Recombinant Human Protein quaking (QKI)

Code CSB-EP842739HU
Abbreviation Recombinant Human QKI protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
QKI
Uniprot No.
Research Area
Neuroscience
Alternative Names
DKFZp586I0923; HKQ; Homolog of mouse quaking QKI KH domain RNA binding protein; Hqk; HQK1; HqkI; OTTHUMP00000017581; OTTHUMP00000017582; OTTHUMP00000017583; Protein quaking; QK; QK1; QK3; QKI; QKI_HUMAN; QKI1; Quaking homolog; Quaking homolog KH domain RNA binding; Quaking homolog KH domain RNA binding mouse; Quaking isoform 1; Quaking protein; RNA binding protein HQK
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-341aa
Target Protein Sequence
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
RNA-binding protein that plays a central role in myelinization. Binds to the 5'-NACUAAY-N(1,20)-UAAY-3' RNA core sequence. Regulates target mRNA stability. In addition, acts by regulating pre-mRNA splicing, mRNA export and protein translation. Required to protect and promote stability of mRNAs such as MBP and CDKN1B. Regulator of oligodendrocyte differentiation and maturation in the brain that may play a role in myelin and oligodendrocyte dysfunction in schizophrenia. Participates in mRNA transport by regulating the nuclear export of MBP mRNA. Also involved in regulation of mRNA splicing of MAG pre-mRNA. Acts as a translational repressor.
Gene References into Functions
  1. Study examined if QKI6B expression can predict the outcome of GFAP, and several oligodendrocyte-related genes, in the prefrontal cortex of brain samples of schizophrenic individuals. QKI6B significantly predicts the expression of GFAP, but does not predict oligodendrocyte-related gene outcome, as previously seen with other QKI isoforms. PMID: 28552414
  2. The results of this study have found an upregulation of QKI and its isoforms (QKI5, QKI6 and QKI7) in Sporadic Alzheimer's Disease patients compared to controls PMID: 27163826
  3. QKI5 could inhibit gastric cancer cell proliferation, migration, and invasion in vitro and in vivo, which might be due to the altered splicing pattern of macroH2A1 pre-mRNA, leading to the accumulation of macroH2A1.1 isoform. PMID: 27092877
  4. several splicing variants with functional relevance in lung cancer largely regulated by the splicing factor QKI, were identified. PMID: 27555542
  5. QKI underexpression is associated with glioma. PMID: 27841882
  6. Our results demonstrate that miR-143-3p acts as a tumor-suppressor by targeting QKI-5 in ESCC, suggesting that miR-143-3p is a potential therapy for the treatment of ESCC. PMID: 27358073
  7. Methylation of the QKI promoter and concomitant reduced expression of QKI mRNA may be important for CRC initiation and progression. PMID: 28179294
  8. quaking is essential in maintaining endothelial barrier function. PMID: 26905650
  9. QKI-7 recruits PAPD4 to regulate post-transcriptional polyadenylation of target mRNAs. PMID: 26926106
  10. QKI has a role in posttranscriptionally guiding macrophage identity and function. PMID: 27029405
  11. MYB-QKI rearrangements promote tumorigenesis through three mechanisms: MYB activation by truncation, enhancer translocation driving aberrant MYB-QKI expression and hemizygous loss of the tumor suppressor QKI PMID: 26829751
  12. Data implicate QKI in the pathophysiology of inflammation and leukemoogenesis where miR-155 is involved. PMID: 26337206
  13. miR-155 regulates the cell cycle and invasion ability of colon cancer cells via the modulation of QKI expression PMID: 25420938
  14. miR-29a promotes scavenger receptor A expression by targeting QKI during monocyte-macrophage differentiation. PMID: 26056009
  15. QKI is a novel Cancer stem cells (CSC) inhibitor and impaired multiple oral CSC properties via partial repression of SOX2. PMID: 24918581
  16. Using circScreen, study identified the RNA binding protein Quaking (QKI) as a major regulator of circRNA biogenesis in epithelial-mesenchymal transition (EMT) and show that introduction of consensus binding sequences for QKI into the flanking introns is sufficient to cause circRNAs to be produced from exons that normally only undergo canonical linear splicing. PMID: 25768908
  17. QKI as a key regulator of alternative splicing in lung cancer. PMID: 24722255
  18. QKI-mediated repression of FOXO1 may be one of the factors contributing to the oncogenesis and progression of breast carcinoma. PMID: 24398626
  19. the QKI-5 expression may be a novel, independent factor in the prognosis of prostate cancer patients. PMID: 24153116
  20. Propose that QKI is a central regulator of VSMC phenotypic plasticity and that intervention in QKI activity can ameliorate pathogenic, fibroproliferative responses to vascular injury. PMID: 23963726
  21. Data showed that like QKI5/6/7 proteins, QKI7b protein was also significantly downregulated in most human colorectal cancer tissues. PMID: 23440637
  22. QKI is a hub regulator of glia function in humans. PMID: 23321059
  23. This work provides the first evidence that QK is a global regulator of splicing during muscle development in vertebrates and shows how overlapping splicing regulatory networks contribute to gene expression programs during differentiation. PMID: 23525800
  24. Findings suggest that miR-574-5p is a potent ribo-regulator for Qkis and that aberrant miR-574-5p upregulation can be oncogenic. PMID: 22490519
  25. The RNA-binding protein QKI5 is a direct target of C/EBPalpha and delays macrophage differentiation. PMID: 22398723
  26. establish that p53 directly regulates Quaking (QKI) gene expression, and QKI protein associates with and leads to the stabilization of miR-20a PMID: 22751500
  27. Multivariate analysis showed QKI expression was an independent prognostic factor for patient survival. PMID: 22569043
  28. The QKI RNA-binding proteins regulate oligodendrocyte differentiation by modulating the expression of AIP-1. PMID: 20631256
  29. E2F1 directly transcribes QKI, which, in turn, negatively regulates the cell cycle by targeting multiple cell cycle regulators, forming an E2F1-QKI-pRb/E2F1 negative feedback loop. PMID: 21768773
  30. QKI, regulates the alternative splicing of macroH2A1 pre-mRNA, resulting in increased levels of macroH2A1.1. PMID: 21844227
  31. HSV-1 infection promotes quaking RNA binding protein production and induces nuclear-cytoplasmic shuttling of quaking I-5 isoform in human hepatoma cells PMID: 21467216
  32. QKI-7 regulates expression of interferon-related genes in human astrocyte glioma cells. PMID: 20927331
  33. QKI functions as a principal regulator in the differentiation of colon epithelium and a suppressor of carcinogenesis through coordinately targeting multiple genes associated with cell growth and differentiation PMID: 19686745
  34. QKI as a possible target for functional studies related to the role of myelination in schizophrenia. PMID: 16342280
  35. QKI levels may regulate oligodendrocyte differentiation and maturation in human brain PMID: 16641098
  36. Since QKI plays a fundamental role in oligodendrocyte differentiation and in myelination, its underexpression may be pivotal to, and upstream of, other myelin-associated gene expression abnormalities in schizophrenia. PMID: 17012699
  37. QKI-6 is the major protein isoform responsible for central nervous system (CNS) myelination, which promotes myelin basic protein expression in oligodendrocytes. PMID: 17079655
  38. biological functions attributed to this KH-type RNA binding protein and the recent achievements linking it to human disorders PMID: 17787018
  39. we examined expression of QKI and several putative mRNA targets of QKI in human PFC and hippocampus at different ages PMID: 17918747
  40. variants within the promoter region of QKI gene are unlikely to play a major role in susceptibility to schizophrenia in the Chinese population PMID: 18938205
  41. The observation of consistent reductions in multiple isoforms of QKI mRNA in depressed suicide victims supports the growing body of evidence for a role of myelination-related deficits in the etiology of psychiatric disorders PMID: 19545858
  42. There are many isoforms of this RNA binding protein. QKI-6 has been shown to be a translational repressor. PMID: 10535969

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Tissue Specificity
Expressed in the frontal cortex of brain. Down-regulated in the brain of schizophrenic patients.
Database Links

HGNC: 21100

OMIM: 609590

KEGG: hsa:9444

STRING: 9606.ENSP00000355094

UniGene: Hs.510324

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*