Recombinant Human Proteoglycan 4 (PRG4), partial

Code CSB-EP018672HU
Abbreviation Recombinant Human PRG4 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
PRG4
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Lubricin;Megakaryocyte-stimulating factor;Superficial zone proteoglycan
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-156aa
Target Protein Sequence
QDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDFKRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAPPPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in boundary lubrication within articulating joints. Prevents protein deposition onto cartilage from synovial fluid by controlling adhesion-dependent synovial growth and inhibiting the adhesion of synovial cells to the cartilage surface.; Isoform F plays a role as a growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages.
Gene References into Functions
  1. Inflammatory Biomarker Profiling in Total Joint Arthroplasty and Its Relevance to Circulating Levels of Lubricin, a Novel Proteoglycan. PMID: 29683034
  2. Intra-articular injection of human PRG4 in vivo in Prg4-/- mice prevented caspase-3 activation in superficial zone chondrocytes and was associated with a modest decrease in whole joint friction. PMID: 28604608
  3. PRG4 plays an important anti-inflammatory role in regulating osteoarthritis synoviocyte proliferation. PMID: 28482921
  4. IL6 and PRG4 represent potential novel tissue biomarkers of disease severity and prognosis in conjunctival fibrosis after glaucoma surgery. PMID: 28975281
  5. adult talar cartilage increases both PRG4 release and biosynthetic activity as immediate cellular response to injury PMID: 27551813
  6. Double knockdown of PRG4 and IL-24 did not inhibit myxoid liposarcoma (MLS)- cell growth, and single knockdown of PRG4 remarkably increased IL-24 expression. These results suggest that the growth inhibitory effect of PRG4 knockdown is caused by induction of IL-24 expression, and PRG4 may contribute to maintain MLS cell growth through repression of IL-24 expression. PMID: 28192118
  7. lubricin expression may typify adaptive and neoplastic changes along a pathway toward fibroblast-like synoviocytes PMID: 26924731
  8. PRG4 binds to TLR2 and TLR4 and this binding mediates a novel anti-inflammatory role for PRG4. PMID: 26643105
  9. Cartilage derived from MSCs expressed lubricin protein both in vitro and in vivo PMID: 26867127
  10. no synovial fluid level differences detected between healthy knees and injured knees PMID: 26037740
  11. The finding that rhPRG4 can increase the viscosity of low concentration HA solutions suggests that supplementation with rhPRG4 may help mitigate the loss in synovial fluid viscosity experienced with decreased HA concentration in osteoarthritis. PMID: 25818000
  12. PRG4 is a novel putative ligand for CD44 and may control synoviocyte overgrowth in inflammatory arthropathies via a CD44-mediated mechanism. PMID: 25708025
  13. The O-glycomap of lubricin, a novel mucin responsible for joint lubrication, has been identified by site-specific glycopeptide analysis. PMID: 25187573
  14. Lubricin (Prg4) plays a role in preventing damage to the superficial zone and preservation of chondrocytes. [Review] PMID: 25172828
  15. 5 novel PRG4 mutations and the first case of CACP syndrome resulting from uniparental disomy of chromosome 1. PMID: 23756439
  16. We speculate that an important role of lubricin in mediating interactions at the cartilage surface is to attach to the cartilage surface and provide a protective coating that maintains the contacting surfaces in a sterically repulsive state. PMID: 24406099
  17. Lubricin is transcribed, translated, and expressed by ocular surface epithelia. Lubricin presence significantly reduces friction between the cornea and conjunctiva. PMID: 23599181
  18. The objective was to evaluate the presence and distribution of the lubricating and anti-adhesion glycoprotein lubricin and cells containing the contractile isoform smooth muscle alpha-actin (SMA) in pseudomembranes around loose hip prostheses. PMID: 23174700
  19. the identification of a novel null mutation in PRG4 confirming the genetic homogeneity of Camptodactyly-arthropathy-coxa vara-pericarditis syndrome . PMID: 22678705
  20. Production and accumulation of the superficial zone protein (SZP), also known as lubricin, by the surface zone is a characteristic feature of articular cartilage. PMID: 22490392
  21. Lubricin in human breast tissue expander capsules PMID: 22865664
  22. lubricin is able to bind to PMN via an L-selectin-dependent and -independent manner and may play a role in PMN-mediated inflammation. PMID: 22930755
  23. lubricin is expressed in the TMJ disc bilaminar zone; lubricin may have a role in normal disc posterior attachment physiology through the prevention of cellular adhesion as well as providing lubrication during normal bilaminar zone function PMID: 21955422
  24. Lubricin is expressed in chondrocytes derived from osteoarthritic cartilage encapsulated in poly (ethylene glycol) diacrylate scaffold. PMID: 22073377
  25. The surface layer of lubricin coating torn edges of anterior cruciate ligaments and menisci may interfere with the integrative healing process needed for repair. PMID: 21647956
  26. We described a 2-bp novel deletion mutation in PRG4 gene in a Pakistani family with camptodactyly-arthropathy-coxa-vara-pericarditis syndrome PMID: 21565623
  27. O-linked oligosaccharides NeuAc alpha2-3Gal beta1-3GalNAc and NeuAc alpha2-3Gal beta1-3(NeuAc alpha2-6)GalNAc were the dominating structures on lubricin. The latter was more prevalent in rheumatoid arthritis, indicating that sialylation is up-regulated. PMID: 20443780
  28. HAPO enhanced total adherence of HUVEC in a concentration-dependent manner. PMID: 19900364
  29. Mrna present in tendons from tennis elbow. PRG4 may also be expressed as alternatively spliced form lacking exons which encode part of the N-terminal matrix-binding and cell-proliferative domain. PMID: 12475643
  30. Megakaryocyte stimulating factor (msf) is linked to prosthetic loosening. PMID: 12783322
  31. data suggest that HAPO is a novel growth factor acting on the primitive cells of both hematopoietic and endothelial cell lineages [HAPO] PMID: 14976050
  32. hemangiopoietin is encoded by HAPO, also known as CACP, MSF, SZP, and PRG4 [editorial] PMID: 15710563
  33. Results describe the production of antibodies against human lubricin to determine the consequence of disease-causing mutations at the protein level and to study the protein's normal post-translational processing. PMID: 16000300
  34. PRG4 mutations may have a role camptodactyly-arthropathy-coxa vara-pericarditis in Saudi families PMID: 16429407
  35. In the human knee, cartilaginous deposits and osteoarthritic cartilage contained PRG4 in patients with advanced knee osteoarthritis. PMID: 17343281
  36. Lubricin provides synovial fluid with an ability to dissipate strain energy induced by mammalian locomotion, which is a chondroprotective feature that is distinct from boundary lubrication. PMID: 17404241
  37. synovial fluid lubricin concentrations were significantly reduced at an early stage following anterior cruciate ligament injury when compared with those in the contralateral joint. PMID: 18512776
  38. These findings demonstrate that HAPO induces endothelial cell proliferation through the PI-3K/Akt pathway. PMID: 18769058
  39. findings point to two distinct mechanisms by which rh-lubricin lubricates, one mechanism involving lubricin bound to the tissue surface and the other involving lubricin in solution PMID: 19058183

Show More

Hide All

Involvement in disease
Camptodactyly-arthropathy-coxa vara-pericarditis syndrome (CACP)
Subcellular Location
Secreted.
Tissue Specificity
Highly expressed in synovial tissue, cartilage and liver and weakly in heart and lung. Isoform B is expressed in kidney, lung, liver, heart and brain. Isoform C and isoform D are widely expressed.
Database Links

HGNC: 9364

OMIM: 208250

KEGG: hsa:10216

STRING: 9606.ENSP00000399679

UniGene: Hs.647723

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*