Recombinant Human Proton-coupled zinc antiporter SLC30A1 (SLC30A1), partial

Code CSB-YP3518HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP3518HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP3518HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP3518HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP3518HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Proton-coupled zinc antiporter SLC30A1; Solute carrier family 30 member 1; Zinc transporter 1; SLC30A1 ZNT1
Species
Homo sapiens (Human)
Expression Region
270-308
Target Protein Sequence
YFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTHASVYEA
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in zinc transport out of the cell.
Gene References into Functions
  1. This study showed that there was a significant increase in protein levels of ZnT1 in the prefrontal cortex in Major depressive disorder, relative to control subjects PMID: 27661418
  2. MTF1 heads a hierarchy of zinc sensors, and through controlling the expression of a raft of metallothioneins and other key proteins involved in controlling intracellular zinc levels (e.g. ZnT1) alters zinc buffering capacity and total cellular zinc content. PMID: 26824222
  3. Data indicate that zinc transporters ZnT1 and Zip1 were the most abundantly expressed zinc transporters in leukocytes. PMID: 24488210
  4. ZnT-1 extrudes zinc from mammalian cells by functioning as a Zn(2+)/H(+) exchanger. PMID: 24951051
  5. Data indicate that the expression levels of ZnT and ZIP families in the three cell lines, when treated with high concentration of ZnSO4, increased and decreased corresponding to their functions, respectively. PMID: 23839533
  6. ZnT-1 augments CaV3.1 and CaV3.2 channel signals by stimulating the Ras-ERK pathways. PMID: 22572848
  7. The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease. PMID: 22349685
  8. The metallothionein gene had a higher expression in the blood, when compared to zinc transporters ZnT-1, Zip-1, and Zip-3 (p=0.01 in obese patients. PMID: 21053094
  9. Differentiated Caco-2 cells tolerate significantly higher levels of zinc compared to undifferentiated Caco-2 cells, which was accompanied by upregulated ZnT-1 and downregulated ZIP1 levels. PMID: 21103883
  10. the transporter ZnT1 at the basolateral membrane, regulate the amount of zinc released to the portal circulation for systemic distribution PMID: 21462106
  11. GSPE and EGCG inhibit the expression of zinc-binding metallothioneins and plasma membrane zinc exporter ZnT1 (SLC30A1). PMID: 20471814
  12. our results suggest that alterations in Zn transport proteins ZnT-1, ZnT-4 and ZnT-6 may contribute to the pathology observed in preclinical Alzheimer's disease subjects before onset of clinical symptoms PMID: 19371353
  13. The effects of zinc and cadmium on the expression and membrane localization of metallothioneins and ZNT1 in hepatoma cells are reproted. PMID: 19900532
  14. ZnT-1 expression was found to be augmented in the atria of atrial tachycardia patients. PMID: 20201890
  15. AIDL cells exhibited a lower expression of zinc transporter 1 (ZnT1) and higher expression of ZnT3 than LNCaP cells. PMID: 14662799
  16. Our findings therefore indicate that ZnT-1 modulates the permeation of cations through LTCC, thereby, regulating cation homeostasis through this pathway. PMID: 15451416
  17. correlation analysis of ZnT-1 levels and senile plaque and neurofibrillary tangle counts of Alzheimer's disease showed a significant positive correlation PMID: 16179263
  18. regulation of ZnT-1 protein in human breast cancer xenografts PMID: 17786585
  19. This study provides evidence for increased ZnT-1 expression in atria of patients with atrial fibrillation. PMID: 17971132
  20. hZnT-1 is the most regulated zinc exporter in leukocytes. it i sfound in the plasma membrane. PMID: 17971500
  21. HPV16 E5 protein binds to EVER and ZnT-1 and blocks their negative regulation PMID: 18158319
  22. Data show that ZNT1 is extensively present in the Abeta-positive plaques in the cortex of human AD brains. PMID: 18639746
  23. zinc transporter 1 is an endogenous inhibitor of L-type calcium channels PMID: 19767393

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Cation diffusion facilitator (CDF) transporter (TC 2.A.4) family, SLC30A subfamily
Database Links

HGNC: 11012

OMIM: 609521

KEGG: hsa:7779

STRING: 9606.ENSP00000355968

UniGene: Hs.519469

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×