Recombinant Human Pulmonary surfactant-associated protein B (SFTPB)

Code CSB-EP021173HU
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021173HU-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP021173HU
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
SFTPB
Uniprot No.
Alternative Names
SFTPB; SFTP3; Pulmonary surfactant-associated protein B; SP-B; 18 kDa pulmonary-surfactant protein; 6 kDa protein; Pulmonary surfactant-associated proteolipid SPL(Phe
Species
Homo sapiens (Human)
Expression Region
201-279
Target Protein Sequence
FPIPLPYCWL CRALIKRIQA MIPKGALAVA VAQVCRVVPL VAGGICQCLA ERYSVILLDT LLGRMLPQLV CRLVLRCSM
Protein Length
Full Length of Mature Protein
Tag Info
The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

For YP – what do you mean by no tag? You have YP in no tag?
eg:Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
CSB-YP021173HU >> Yeast 25-35 working days
Expression Region: 201-279aa; Mature full length protein.
Tag information:NO-tagged.
Sequence:

FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

A:
Thanks for your inquiry. Yes, we have successfully expressed this untagged YP protein using the untagged vector , we can send you the previous COA for your reference.
Q:

Could you please then advise on how the protein is purified. Since it does not have any tag?

A:
Thanks for your inquiry. Generally, the purification methods for untagged protein are hydrophobic chromatography, ion exchange, molecular sieves.
For fusion protein with tag, the general purification method is affinity chromatography.

Target Background

Function
Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Gene References into Functions
  1. rs7316 polymorphism associated with respiratory distress syndrome in Iranian premature newborns PMID: 28738720
  2. TGF beta markedly decreased expression of SP-A, SP-B, SP-C, fatty acid synthase, and the phospholipid transporter ABCA3. However, TGF beta increased protein levels of SP-D with little change in mRNA levels. PMID: 29621540
  3. Surfactant protein B suppresses lung cancer progression by inhibiting secretory phospholipase A2 activity and arachidonic acid production. PMID: 28743125
  4. Data show that the thermal transitions observed in N-terminal propeptide of proSP-B (SP-BN) may correspond to the unfolding of certain protein domains or subdomains and/or to oligomers dissociation whereas the overall protein shows resistance to temperature-induced unfolding up to ~ 86 degrees C. PMID: 27380171
  5. SP-A (+186A/G) and SP-B (1580C/T) polymorphisms are strongly associated with the risk of respiratory distress syndrome (RDS) in preterm infants. Notably, reduced serum SP-A levels were correlated with a high risk of RDS and may serve as novel biomarkers for RDS detection and monitoring. PMID: 28011976
  6. Differences were found regarding SPA and pro-SPB expression in the vast majority of subjects: in some lungs, SPA was more expressed whereas in others pro-SPB showed an higher degree of immunoreactivity. The expression of both surfactant proteins was not strictly correlated with gestational age. PMID: 27734990
  7. There is no significant association between the gene polymorphism of the R236C site in exon 7 of SP-B gene and the incidence ofneonatal respiratory distress syndrome (NRDS) in Han populations in that region. PMID: 27655533
  8. Rare mutations in surfactant-associated genes contribute to neonatal respiratory distress syndrome. The frequency of mutations in these genes in the Chinese population is unknown. We resequenced all exons of the surfactant protein-B (SFTPB) and we did not find any rare mutations in SFTPB PMID: 26547207
  9. mice with SP-B-C allele are more susceptible to S. aureus pneumonia than mice with SP-B-T allele, and that CMC2.24 attenuates lung injury thus reducing mortality. PMID: 26863117
  10. In term newborns with pneumonia, SP-B increases with respect to total phospholipids, and disaturated-phosphatidylcholine and is turned over at a faster rate. PMID: 26107393
  11. SP-B -18C/A and 1580C/T polymorphisms are associated with bronchopulmonary dysplasia PMID: 26045806
  12. These results demonstrate for the first time that human SP-B C allele is more susceptible to bacterial pneumonia than SP-B T allele in vivo. PMID: 26620227
  13. Significant differences in frequency of occurrence of unfavorable genotypes CC rs1965708, AA rs1059046 of SFTPA2 gene and CC rs1130866 of SFTPB gene in influenza patients in comparison with individuals of the control group were not detected. PMID: 26950992
  14. Investigated the relationship between SP-A2 and SP-B gene polymorphisms and respiratory distress syndrome in preterm neonates. PMID: 26061924
  15. Given these fact SP-B deficiency may be considered as a further field for research on regenerative therapy i. e. stem cell administration in models of postnatal SP-B deficiency. PMID: 25565191
  16. Results support a critical role of SP-B for promoting pulmonary surface film formation. PMID: 25360829
  17. SFTPB variants are associated with chronic obstructive pulmonary disease susceptibility and lung function in the Chinese Han population. PMID: 25299874
  18. Surfactant protein B gene polymorphism is associated with severe influenza. PMID: 24337193
  19. data support the hypothesis that proSP-B glycosylation due to Ile131Thr variation may have a causal role in genetic susceptibility to acute respiratory distress PMID: 24002332
  20. It was concluded that the polymorphisms of SP-B intron 4 and C/A-18 could be associated with BPD in Chinese Han infants, and the del allele of intron 4 and A allele of C/A-18 might be used as markers of susceptibility in the disease. PMID: 23771654
  21. there was no evidence for any association between common polymorphisms in the SP-B and SP-D genes and COPD risk (all p>0.05). PMID: 24093802
  22. Glucocorticoids mediated surfactant protein B production, maturation, and release is amplified by caffeine. PMID: 24163141
  23. macrophages participate in the repression of SFTPB expression by LPS, and that macrophage-released cytokines (including TNF) regulate the transcription factor CEBPB PMID: 23590297
  24. D2S388-5 microsatellite polymorphism of surfactant protein B may be associated with susceptibility to COPD in Xinjiang Kazakhs. PMID: 23088317
  25. elevated expression in nasal mucosa in chronic rhinosinusitis with polyps PMID: 23406594
  26. Mutations in exon 4 of the surfactant protein B gene demonstrate an association between homozygous mutations with C/C genotype in SP-B gene and neonatal respiratory distress. PMID: 23330012
  27. caffeine is able to induce the expression of SP-transcription factors and affects the signaling pathways of glucocorticoids, amplifying their effects PMID: 23272120
  28. The results indicate that tryptophan oxidation causes substantial disruptions in helical structure and lipid interactions. PMID: 21128671
  29. review focuses on published association studies of surfactant proteins A and D genetic polymorphisms with respiratory, and non-respiratory diseases in adults, children, and newborns [review] PMID: 22201752
  30. The present study demonstrated that the AG genotype of AG 9306 polymorphism was a protective factor against the development of respiratory distress syndrome, other polymorphisms studied (G/C at 8714, C/T at 1580, A/C at -18) were not associated with RDS. PMID: 21180884
  31. In patients undergoing major vascular abdominal surgery, SP-B values increase progressively during mechanical ventilation stages compared to advanced glycation end-products (RAGE) kinetics. PMID: 21736957
  32. SP-B 1580C/T polymorphism contributes to the etiology of respiratory distress syndrome. PMID: 22289747
  33. Circulating levels of SP-B increase with greater smoking burden and independently associate with abdominal abdominal aortic plaque among current smokers. PMID: 21817103
  34. Genetic variations in the gene coding for surfactant protein B are associated with more severe lung injury as indicated by the association of specific single nucleotide polymorphism genotypes and haplotypes PMID: 21283003
  35. Surfactant protein B and RAGE increases in the plasma during cardiopulmonary bypass PMID: 20650982
  36. Surfactant protein B polymorphisms have a role in pulmonary function and COPD PMID: 20693256
  37. Disaturated-phosphatidylcholine and surfactant protein-B have a different turnover both in healthy and diseased lungs. PMID: 21429235
  38. Absence of this protein resulted in Congenital pulmonary alveolar proteinosis in two newborn children PMID: 20005435
  39. Surfactant protein-B 121ins2 heterozygosity is associated with reduced lung function and increased risk for COPD among smokers PMID: 19833825
  40. review of lipid-protein interactions of hydrophobic proteins SP-B and SP-C in lung surfactant assembly and dynamics PMID: 11699574
  41. Data suggest that SMAD3 interactions with the positive regulators NKX2.1 and HNF-3 underlie the molecular basis for TGF-beta-induced repression of surfactant protein B gene transcription. PMID: 12161428
  42. role of Differences in N-linked glycosylation between human surfactant protein-B variants of the C or T allele at the single-nucleotide polymorphism at position 1580 in disease PMID: 12356334
  43. suggest that polymorphisms in intron 4 of the surfactant protein B gene independently modify the course of neonatal respiratory distress syndrome PMID: 12424586
  44. An association between SP-B polymorphism and RDS was found in premature, first-born twins. In particular, the threonine allele was associated with an increased risk of RDS. PMID: 12483294
  45. dimeric SP-B(1-25) is more efficient in restoring lung function in neonatal RDS and ARDS than monomeric SP-B(1-25) surfactant. PMID: 12490037
  46. surfactant protein B expression is regulated by an enhancer region which binds to thyroid transcription factor-1, retinoic acid receptor, signal transducers and activators of transcription 3, nuclear receptor coactivators (SRC-1, ACTR, TIF2, and CBP/p300 PMID: 12573987
  47. Mutataions and Polymorphisms in SFTPB is associated with severe unexplained respiratory distress PMID: 12784301
  48. SP-B expression is regulated by PPARgamma in the lung PMID: 12829715
  49. Reduced SP-B expression due to elevated nitric oxide levels can contribute to lung injury. PMID: 12896877
  50. In human lungs, mature SP-B is involved in the structural organization of lamellar bodies and tubular myelin by the formation of core particles. PMID: 12972403

Show More

Hide All

Involvement in disease
Pulmonary surfactant metabolism dysfunction 1 (SMDP1); Respiratory distress syndrome in premature infants (RDS)
Subcellular Location
Secreted, extracellular space, surface film.
Database Links

HGNC: 10801

OMIM: 178640

KEGG: hsa:6439

STRING: 9606.ENSP00000377409

UniGene: Hs.512690

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1