Code | CSB-EP021173HU |
Size | Pls inquire |
Source | E.coli |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-EP021173HU-B |
Size | Pls inquire |
Source | E.coli |
Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
Have Questions? | Leave a Message or Start an on-line Chat |
Code | CSB-MP021173HU |
Size | Pls inquire |
Source | Mammalian cell |
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
For YP – what do you mean by no tag? You have YP in no tag?
eg:Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
CSB-YP021173HU >> Yeast 25-35 working days
Expression Region: 201-279aa; Mature full length protein.
Tag information:NO-tagged.
Sequence:
FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Could you please then advise on how the protein is purified. Since it does not have any tag?