Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Code CSB-YP021173HU
Product Type Recombinant Protein
Size US$2640
Uniprot No. P07988
Relevance Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL(Phe)
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM
Research Area Cell Biology
Source Yeast
Gene Names SFTPB
Protein Names Recommended name: Pulmonary surfactant-associated protein B Short name= SP-B Alternative name(s): 18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL(Phe)
Expression Region 201-279aa
Tag Info Tag-Free
Mol. Weight 8.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Involvement in disease Pulmonary surfactant metabolism dysfunction 1 (SMDP1); Respiratory distress syndrome in premature infants (RDS)
Subcellular Location Secreted, extracellular space, surface film
Database Links

HGNC: 10801

OMIM: 178640

KEGG: hsa:6439

STRING: 9606.ENSP00000377409

UniGene: Hs.512690

Related Products

SFTPB Antibodies

SFTPB Antibodies for Homo sapiens (Human)

SFTPB Proteins

SFTPB Proteins for Homo sapiens (Human)

SFTPB ELISA Kit

SFTPB ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.