Recombinant Human Pyridoxal kinase(PDXK)

Code CSB-EP017748HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O00764
Relevance Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Pyridoxine kinase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL
Research Area Signal Transduction
Source E.coli
Gene Names PDXK
Protein Names Recommended name: Pyridoxal kinase EC= 2.7.1.35 Alternative name(s): Pyridoxine kinase
Expression Region 1-312aa
Tag Info N-terminal GST-tagged
Mol. Weight 62.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for synthesis of pyridoxal-5-phosphate from vitamin B6.
Subcellular Location Cytoplasm
Protein Families Pyridoxine kinase family
Tissue Specificity Ubiquitous. Isoform 3 is detected in adult testis and spermatozoa.
Database Links

HGNC: 8819

OMIM: 179020

KEGG: hsa:8566

STRING: 9606.ENSP00000291565

UniGene: Hs.284491

Related Products

PDXK Antibodies

PDXK Antibodies for Homo sapiens (Human)

PDXK Antibodies for Human

PDXK Proteins

PDXK Proteins for Homo sapiens (Human)

PDXK ELISA Kit

PDXK ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.