Recombinant Human Pyrin (MEFV), partial

Code CSB-YP013675HU(A4)
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP013675HU(A4)
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP013675HU(A4)-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP013675HU(A4)
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP013675HU(A4)
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
FMF; Marenostrin; Mediterranean fever; Mediterranean fever protein; MEF; Mefv; MEFV_HUMAN; Pyrin; TRIM20
Species
Homo sapiens (Human)
Expression Region
375-781
Target Protein Sequence
CKRHLKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEALKQRVQRKLEQVYYFLEQQEHFF VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT VPVPEKWTTPQEIKQKIQLLHQKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVG DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI FVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGPD
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the regulation of innate immunity and the inflammatory response in response to IFNG/IFN-gamma. Organizes autophagic machinery by serving as a platform for the assembly of ULK1, Beclin 1/BECN1, ATG16L1, and ATG8 family members and recognizes specific autophagy targets, thus coordinating target recognition with assembly of the autophagic apparatus and initiation of autophagy. Acts as an autophagy receptor for the degradation of several inflammasome components, including CASP1, NLRP1 and NLRP3, hence preventing excessive IL1B- and IL18-mediated inflammation. However, it can also have a positive effect in the inflammatory pathway, acting as an innate immune sensor that triggers PYCARD/ASC specks formation, caspase-1 activation, and IL1B and IL18 production. It is required for PSTPIP1-induced PYCARD/ASC oligomerization and inflammasome formation. Recruits PSTPIP1 to inflammasomes, and is required for PSTPIP1 oligomerization.
Gene References into Functions
  1. A novel single base mutation in the coding region of the MEFV gene, named K447M (p.Lys447Met, c.1340 A>T) heterozygote resulting in mutated Pyrin/Marenostrin protein was detected. PMID: 30226974
  2. Propose that a variant allele of the MEFV gene may be responsible for the severity of gout. PMID: 27125729
  3. its single-nucleotide variant is genetic predictor of tumor reduction in glucocorticoid-treated patients with chronic myelomonocytic leukemia. PMID: 29600428
  4. Carrying the pro-inflammatory M694V mutation in MEFV can be a potential cause of early coronary heart disease. PMID: 24702757
  5. R202Q/M694V gene mutations related to chronic periodontitis PMID: 28590056
  6. Carriage of mutations in the MEFV gene is not associated with development of Postpericardiotomy Syndrome; however, it may affect Postpericardiotomy Syndrome severity. PMID: 28971640
  7. One third of our childhood MS patients had a heterozygous mutation in the TNFRSF1A and/or MEFV gene. This proportion by far exceeds the number of mutations expected and was higher than in adult MS patients, suggesting that these mutations might contribute to the pathogenesis of childhood MS. PMID: 28927886
  8. The frequency of MEFV gene mutation was detected at a high rate of 35.9% in patients with biopsy-proven primary glomerulonephritis PMID: 28573371
  9. Sequencing analysis found exon 2 mutations of the MEFV gene (c.329T>C [L110P], and c.442G>C [E148Q]). INTERVENTION: Her arthritis was well-controlled with colchicine treatment, but fever, and rashes were not. OUTCOMES: She eventually received tocilizumab, in addition to colchicine, and her symptoms completely disappeared. LESSONS: MEFV mutations may exist in AOSD patients, and treatment with colchicine might PMID: 29642170
  10. Pyrin inflammasome activation persisted upon microtubule disassembly in PBMCs of FMF patients but not in cells of patients afflicted with other autoinflammatory diseases. PMID: 27911804
  11. A novel missense MEFV variant R204H was identified in Iranian familial Mediterranean fever patients. M694V is the most common MEFV mutation in Iran. PMID: 28943464
  12. This article summarizes the broad spectrum of clinical presentations associated with MEFV mutations and analyzes the effect of the gene dose on the phenotypical expression. Furthermore, the impact of the molecular genetic analysis on the diagnostics of a patient and on the individualized management of the disease is discussed. PMID: 28154935
  13. Case Report: autoinflammatory syndrome with relapsing aseptic neutrophilic meningitis and chronic myelitis associated with MEFV/TNFRSF1A mutations. PMID: 28134085
  14. The mutations of p.R42W, p.L110P, p.E148Q, p.R202Q, p.E230K, p.369PS, and p.R408Q, which have been reported in many Familial Mediterranean Fever patients, had significant allele frequency differences with the disease-causing mutations. PMID: 29178647
  15. Contrary to the NLRP3 mutations described in cryopyrin-associated periodic syndrome, FMF-associated MEFV mutations do not lead to a constitutive activation of Pyrin. Rather, FMF-associated mutations are hypermorphic mutations that specifically decrease the activation threshold of the Pyrin inflammasome without affecting other canonical inflammasomes. PMID: 29040788
  16. There was a statistically significant different response to surgical treatment between patients with periodic fever, aphthosis, pharyngitis, and adenitis (PFAPA) Syndrome with and without coexistence of Familial Mediterranean Fever features and MEFV mutations. PMID: 29031862
  17. The study indicates that the MEFV M694V mutation may contribute to the pathogenesis of ankylosing spondylitis. (Meta-analysis) PMID: 28800602
  18. The authors evaluated the distribution of MEFV mutations in a Turkish population. Their findings confirm the correlation between M694V and FMF associated amyloidosis found in earlier studies. PMID: 27225717
  19. we found a significant association between genotypes of variants in rs3743930 with increased Henoch-Schonlein purpura risk, after covariates adjustment. The carriers of homozygous mutant of rs3743930 polymorphisms revealed increased HSP risk than those with wild-type homozygotes. PMID: 27796522
  20. MEFV gene variations in exons 2, 3, 5 and 10 associate with major clinical symptoms of familial Mediterranean fever. Arthritis was high in K695R heterozygous genotype. PMID: 28483595
  21. These results provide a novel mechanism underlying the anti-inflammatory effects of carbon monoxide, involving the IL-10-dependent upregulation of pyrin expression. PMID: 26435068
  22. High carriage rates of MEFV gene mutations in gouty arthritis suggest that it may play an important role in the pathogenesis of the disease and predisposition to the disease. PMID: 27587294
  23. The p.M694del variant is associated with autosomal dominantly inherited FMF in Northern European Caucasians. PMID: 27150194
  24. Inflammatory bowel disease patients, in populations with a high background carrier rate of MEFV variants, should be screened for MEFV gene mutations, especially those diagnosed as indeterminate colitis. PMID: 25292286
  25. This study showed that the medium- to long-term results of the kidney donors who are carriers of the MEFV gene seem to be safe. PMID: 28340799
  26. this paper show that the binding of 14-3-3 and PKN proteins to familial Mediterranean fever -associated mutant pyrin is substantially decreased PMID: 27270401
  27. We report two patients with mutations in pyrin presenting with recurrent infections and infantile colitis due to familial Mediterranean fever, thus illustrating how an autoinflammatory disorder can mimic a PID. PMID: 27538774
  28. RHEB, the main activator of mTOR signaling, is a valid target of miR-4520a with the relative expression levels of the latter being significantly deregulated in FMF patients and highly dependent on the presence of pyrin mutations. PMID: 27636101
  29. A patient with Mediterranean fever, her sisters and mother, all had tonsillectomy for tonsillitis, carried heterozygous alterations involving E148Q/P369S/R408Q. PMID: 28001092
  30. demonstrated the novel gene mutation in exon 2 of MEFT. We assumed the MEFV mutation was related to the pathogenesis of pyoderma gangrenosum in our cases PMID: 26537665
  31. Three novel MEFV variants, A66P, R202W and H300Q, were identified among carriers of familial Mediterranean fever in a large cohort of Iranian population. PMID: 27659338
  32. Healthy individuals may bear E148Q and K695R MEFV gene mutations, as well as R202Q polymorphism in homozygous state. The determined gene alterations contribute to a subtle oxidative stress and may be associated with more frequent episodes of fever and unspecific inflammatory manifestations. PMID: 27364639
  33. the presence of homozygous M694V gene mutation seems to increase the risk for periodontitis in familial Mediterranean fever patients. PMID: 26400644
  34. It was found that the most common four mutations (M694V, M680I [G/C], E148Q, V726A) were similar to those previously reported from different regions of Turkey. PMID: 26892483
  35. Describe the MEFV mutational spectrum and distribution in a healthy Turkish population, and report a carrier rate that is much higher than expected. PMID: 27791953
  36. This study shows that p.M694I homozygosity in MEFV is a potential genetic risk factor for the development of renal AA-amyloidosis in Algerian Familial Mediterranean fever patients. PMID: 27956278
  37. Fever and MEFV gene M694V homozygosity were less frequently detected in Familial Mediterranean fever. PMID: 26842301
  38. Correlate MEFV genotype and the SAA1 polymorphisms with the clinical manifestations of familial Mediterranean fever and the occurrence of amyloidosis in a large cohort of Armenian patients. PMID: 27791951
  39. a guard-like mechanism of pyrin regulation, originally identified for Nod-like receptors in plant innate immunity, also exists in humans. PMID: 27030597
  40. Most patients presenting with PFAPA syndrome have heterozygous MEFV gene mutations. PMID: 26360812
  41. When compared with the control group, a lower prevalence of the MEFV gene mutation carrier was found in sarcoidosis patients but this was not statistically significant. PMID: 27053370
  42. Most of the very early-onset patients were homozygous for M694V mutations, tended to have more severe symptoms, required relatively high doses of colchicine to control their disease, and were diagnosed after a significant delay. PMID: 27228648
  43. As colchicine treatment not only improved the myofascial pain but also prevented FMF-associated amyloidosis and nephropathy, differential diagnosis of fibromyalgia in patients of Mediterranean origin should include FMF and a genetic screening of MEFV. PMID: 25604326
  44. MEFV mutations M694V and M680I are associated with Behcet's disease. [meta-analysis] PMID: 26176758
  45. Carrier rate for MEFV mutations was lower in the SLE group, which is in agreement with previous observations that FMF may confer some protection from SLE. Exon 10 mutations were associated with SLE nephritis after the exclusion of the E148Q mutation. PMID: 25413357
  46. There was no statistically significant difference between patients and controls in incidence of -1661 A/G single nucleotide polymorphism CTLA4 nor with the clinical symptoms of Familial Mediterranean Fever and MEFV gene mutations. PMID: 25643856
  47. The presence of M694V was found to be associated with more severe course of FMF, earlier age of onset and more frequent arthritis in the Syrian children with FMF compared to other FMF patients who do not have this mutation. PMID: 25150514
  48. Among the MEFV gene mutations M694V (mainly) and also V726A and M680I were the most common ones PMID: 25617110
  49. In this study, we investigated whether the full-length MEFV gene (MEFV-fl) and the exon 2-deleted splice isoform (MEFV-d2) expression are associated with or responsible for the clinical conditions of Rheumatoid arthritis PMID: 25730039
  50. MEFV mutation-negative familial Mediterranean fever (FMF) by virtue of its classical FMF phenotype is probably associated with a genetic defect upstream or downstream to MEFV related metabolic pathway. PMID: 25887307

Show More

Hide All

Involvement in disease
Familial Mediterranean fever, autosomal recessive (ARFMF); Familial Mediterranean fever, autosomal dominant (ADFMF)
Subcellular Location
[Isoform 1]: Cytoplasm, cytoskeleton. Cell projection, ruffle. Cell projection, lamellipodium. Nucleus. Cytoplasm. Cytoplasmic vesicle, autophagosome. Note=Associated with microtubules and with the filamentous actin of perinuclear filaments and peripheral lamellar ruffles. In pre-apoptotic cells, colocalizes with PYCARD/ASC in large specks (inflammasomes). In migrating monocytes, strongly polarized at the leading edge of the cell where it colocalizes with polymerizing actin and PYCARD/ASC.; [Isoform 2]: Nucleus.
Tissue Specificity
Expressed in peripheral blood leukocytes, particularly in mature granulocytes and to a lesser extent in monocytes but not in lymphocytes. Detected in spleen, lung and muscle, probably as a result of leukocyte infiltration in these tissues. Not expressed i
Database Links

HGNC: 6998

OMIM: 134610

KEGG: hsa:4210

STRING: 9606.ENSP00000219596

UniGene: Hs.632221

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1