Home
Protein
Recombinant Proteins
Recombinant Human [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial (PDP2)

Recombinant Human [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial (PDP2)

^{In Stock}

Code	CSB-EP868395HU
Abbreviation	Recombinant Human PDP2 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PDP2

Uniprot No.

Q9P2J9

Research Area

Metabolism

Alternative Names

[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2; KIAA1348 ; mitochondrial; PDP 2; Pdp2; PDP2_HUMAN; PDPC 2; PPM2B; PPM2C2; Protein phosphatase 2C magnesium dependent catalytic subunit 2; Protein phosphatase Mg2+/Mn2+ dependent 2B; Pyruvate dehydrogenase phosphatase 2; Pyruvate dehydrogenase phosphatase catalytic subunit 2; pyruvate dehydrogenase phosphatase isoenzyme 2 ; Pyruvate dehydrogenase phosphatase; catalytic subunit 2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

67-529aa

Target Protein Sequence

STEEDDFHLQLSPEQINEVLRAGETTHKILDLESRVPNSVLRFESNQLAANSPVEDRRGVASCLQTNGLMFGIFDGHGGHACAQAVSERLFYYVAVSLMSHQTLEHMEGAMESMKPLLPILHWLKHPGDSIYKDVTSVHLDHLRVYWQELLDLHMEMGLSIEEALMYSFQRLDSDISLEIQAPLEDEVTRNLSLQVAFSGATACMAHVDGIHLHVANAGDCRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMEDRLLGVLIPCRAFGDVQLKWSKELQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVLASDGLWDMLSNEDVVRLVVGHLAEADWHKTDLAQRPANLGLMQSLLLQRKASGLHEADQNAATRLIRHAIGNNEYGEMEAERLAAMLTLPEDLARMYRDDITVTVVYFNSESIGAYYKGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

56.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human PDP2 protein expression in e.coli cells requires the insertion of a DNA fragment encoding the Human PDP2 protein (67-529aa) into a plasmid vector and the transferral of this vector into e.coli cells. The positive cells are screened, cultured, and then induced to express the PDP2 protein. The protein carries a N-terminal 6xHis tag. The cells are lysed to harvest the recombinant Human PDP2 protein, which is purified through affinity purification and then detected by SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of this recombinant Human PDP2 protein is over 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

Gene References into Functions

ICER was found to bind to the Pdp2 promoter and suppress its expression. Furthermore, forced expression of PDP2 in CD4(+) cells reduced the in vitro Th17 differentiation, whereas shRNA-based suppression of PDP2 expression increased in vitro Th17 differentiation PMID: 30150402
catalytic subunit of PDP2 crystals belonged to space group P2(1)2(1)2(1), with unit-cell parameters a = 53.6, b = 69.1, c = 109.7 A. PMID: 20208177

Subcellular Location

Mitochondrion matrix.

Protein Families

PP2C family

Database Links

HGNC: 30263

OMIM: 615499

KEGG: hsa:57546

STRING: 9606.ENSP00000309548

UniGene: Hs.632214

Promotions