Recombinant Human REST corepressor 1 (RCOR1), partial,Biotinylated

In Stock
Code CSB-EP019515HU-B
Abbreviation Recombinant Human RCOR1 protein, partial, Biotinylated
MSDS
Size $472
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
RCOR1
Uniprot No.
Research Area
Cancer
Alternative Names
Protein CoREST
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
4-485aa
Target Protein Sequence
MVEKGPEVSGKRRGRNNAAASASAAAASAAASAACASPAATAASGAAASSASAAAASAAAAPNNGQNKSLAAAAPNGNSSSNSWEEGSSGSSSDEEHGGGGMRVGPQYQAVVPDFDPAKLARRSQERDNLGMLVWSPNQNLSEAKLDEYIAIAKEKHGYNMEQALGMLFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKTFHRIQQMLPDKSIASLVKFYYSWKKTRTKTSVMDRHARKQKREREESEDELEEANGNNPIDIEVDQNKESKKEVPPTETVPQVKKEKHSTQAKNRAKRKPPKGMFLSQEDVEAVSANATAATTVLRQLDMELVSVKRQIQNIKQTNSALKEKLDGGIEPYRLPEVIQKCNARWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRRFNIDEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
100.9 kDa
Protein Length
Partial
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it serves as a molecular beacon for the recruitment of molecular machinery, including MeCP2 and SUV39H1, that imposes silencing across a chromosomal interval. Plays a central role in demethylation of Lys-4 of histone H3 by promoting demethylase activity of KDM1A on core histones and nucleosomal substrates. It also protects KDM1A from the proteasome. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development and controls hematopoietic differentiation.
Gene References into Functions
  1. the intact CoREST complex is targeted with dual histone deacetylase and demethylase inhibitors PMID: 29302039
  2. Expressions of REST and RCOR1 genes may downregulate SYN1 expression in gliomas. PMID: 27685921
  3. Rcor1 knock-out monocytes exhibited extensive self-renewal associated with hematopoietic stem cell expansion. PMID: 26119982
  4. Genomic deletions in RCOR1 are associated with a specific gene expression signature and with unfavorable clinical outcomes in diffuse large B-cell lymphoma patients. PMID: 25395426
  5. a combination of virtual screening and biological approaches can lead to compounds reducing REST complex formation PMID: 23800350
  6. Data show that miR-22 specifically interacts with the 3' UTRs of the Rcor1, Rgs2 and HDAC4 mRNAs. PMID: 23349832
  7. The CoREST and REST are necessary and inimical for expression of herpes simplex virus genes. PMID: 21221247
  8. Insight into the molecular basis of the interaction between scaffolding protein CoREST and histone deacetylase LSD1 may suggest a new means of inhibiting LSD1 activity by misdirecting the enzyme away from nucleosomal substrates. PMID: 21142040
  9. silencing of CoREST by siRNA transfection in normal articular cartilage may reflect CoREST repression in advanced osteoarthritic cartilage, which results in phenotypic genes modulation and suggests a homeostatic role of this transcription factor PMID: 20973059
  10. CoREST does not play an influential role in regulating HSV-1 infection. PMID: 20106915
  11. elevated levels of REST and CoREST in the brain of RTT patients and MeCP2 deficient mice result in downregulation of BDNF, apparently by their binding to the RE1 (element) located between the first two promoters of the BDNF gene PMID: 18075316
  12. CoREST is bound to the hsp70 gene promoter under basal conditions and that its binding increases during heat shock response. PMID: 18657505
  13. These results demonstrate that SUMO-1 modification modulates the transcriptional repression by CoREST and is needed for its full repressive activity. PMID: 18854179
  14. The results indicate that both sets of events mediated by ICP0, the degradation of PML and the blocking of silencing via the HDAC1/2-CoREST-REST complex, are interdependent and in large measure dependent on events in the ND10 nuclear bodies. PMID: 18945770
  15. Direct interactions between CoREST1 and SUMO-2 mediate SUMO-dependent changes in chromatin structure and transcription that are important for cell-type-specific gene expression. PMID: 19394292
  16. Analysis of chromatin modification patterns shows that CoREST are recruited to the c-myc promoter leading to appearance of repressive chromatin marks. PMID: 19522008

Show More

Hide All

Subcellular Location
Nucleus. Note=Upon infection by HSV-1, it is partially translocated into the cytoplasm in an HSV-1-dependent manner.
Protein Families
CoREST family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 17441

OMIM: 607675

KEGG: hsa:23186

STRING: 9606.ENSP00000459789

UniGene: Hs.510521

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*