Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
GTP binding protein RAB 1A; mKIAA3012; RAB 1; Rab 1A; RAB1; RAB1, member RAS oncogene family; Rab1A; RAB1A member RAS oncogene family; RAB1A_HUMAN; Ras related protein Rab 1A; Ras-associated protein RAB1; Ras-related protein Rab-1A; YPT1; YPT1 related protein; YPT1-related protein
Species
Homo sapiens (Human)
Expression Region
2-205aa
Target Protein Sequence
SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human RAB1A contains amino acids 2-205. The expected molecular weight for the RAB1A protein is calculated to be 49.5 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of RAB1A, making it easier to detect and purify the RAB1A recombinant protein in the later stages of expression and purification.
The human Ras-related protein Rab-1A (RAB1A) is a key regulator of intracellular vesicle trafficking. RAB1A functions within the Rab family of small GTPases. RAB1A plays a crucial role in the early secretory pathway, particularly in the transport of vesicles from the endoplasmic reticulum (ER) to the Golgi apparatus. Its main function involves the coordination of vesicle budding, transport, and fusion with target membranes. Additionally, RAB1A has implications for autophagy and cellular homeostasis. Research on RAB1A delves into its specific roles in vesicular transport, its regulatory mechanisms, and its involvement in various cellular processes, providing insights into potential therapeutic targets for diseases associated with membrane trafficking dysregulation.
