Recombinant Human Ras-related protein Rab-1A (RAB1A)

In Stock
Code CSB-EP019167HU
Abbreviation Recombinant Human RAB1A protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
GTP binding protein RAB 1A; mKIAA3012; RAB 1; Rab 1A; RAB1; RAB1, member RAS oncogene family; Rab1A; RAB1A member RAS oncogene family; RAB1A_HUMAN; Ras related protein Rab 1A; Ras-associated protein RAB1; Ras-related protein Rab-1A; YPT1; YPT1 related protein; YPT1-related protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-205aa
Target Protein Sequence
SSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human RAB1A contains amino acids 2-205. The expected molecular weight for the RAB1A protein is calculated to be 49.5 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of RAB1A, making it easier to detect and purify the RAB1A recombinant protein in the later stages of expression and purification.

The human Ras-related protein Rab-1A (RAB1A) is a key regulator of intracellular vesicle trafficking. RAB1A functions within the Rab family of small GTPases. RAB1A plays a crucial role in the early secretory pathway, particularly in the transport of vesicles from the endoplasmic reticulum (ER) to the Golgi apparatus. Its main function involves the coordination of vesicle budding, transport, and fusion with target membranes. Additionally, RAB1A has implications for autophagy and cellular homeostasis. Research on RAB1A delves into its specific roles in vesicular transport, its regulatory mechanisms, and its involvement in various cellular processes, providing insights into potential therapeutic targets for diseases associated with membrane trafficking dysregulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB1A regulates vesicular protein transport from the endoplasmic reticulum (ER) to the Golgi compartment and on to the cell surface, and plays a role in IL-8 and growth hormone secretion. Regulates the level of CASR present at the cell membrane. Plays a role in cell adhesion and cell migration, via its role in protein trafficking. Plays a role in autophagosome assembly and cellular defense reactions against pathogenic bacteria. Plays a role in microtubule-dependent protein transport by early endosomes and in anterograde melanosome transport.
Gene References into Functions
  1. he present study demonstrated that DANCR/miR-634/RAB1A axis plays crucial roles in the progression of glioma, and DANCR might potentially serve as a therapeutic target for the treatment of glioma patients. PMID: 29301870
  2. Rab1 is regulated by the host in a similar fashion, and that the innate immunity kinase TAK1 and Legionella effectors compete to regulate Rab1 by switch II modifications during infection. PMID: 27482120
  3. Rab1A may be involved in the pathogenesis of human lung cancer in an mTOR- and MAPK-independent manner. PMID: 27902464
  4. In clinical samples, the expression of Rab1A or DHX33 was reversely correlated with miR-634. Re-expression of Rab1A or DHX33 abrogated the miR-634-mediated inhibition of cell proliferation and migration. Collectively, our data suggest a tumor suppressor role of miR-634 in hepatocellular carcinoma. PMID: 27693040
  5. New Rab1 binding sites have been discovered using an ensemble of clustering methods. PMID: 28120477
  6. Leucine-rich repeat kinase 2 (LRRK2) can interact with several Rab proteins, and such ractions may serve to recruit LRRK2 to distinct subcellular organelles to phosphorylate select substrate proteins involved in membrane trafficking events. PMID: 28202668
  7. As a Rab1a effector, C9orf72 controls initiation of autophagy by regulating the Rab1a-dependent trafficking of the ULK1 autophagy initiation complex to the phagophore. PMID: 27334615
  8. our data indicate that miR-1202 suppresses proliferation and induces endoplasmic reticulum stress and apoptosis through targeting and inhibiting Rab1A in glioma cells. These results suggest miR-1202 as a potential therapeutic target for the treatment of glioma patients. PMID: 28443461
  9. Upregulation of RAB1A is associated with triple-negative breast cancer. PMID: 28184936
  10. For RAB1A, a high accuracy for the discrimination of human hepatocellular carcinoma and nontumorous liver tissue was observed. PMID: 27467182
  11. The ability of Rab1 to regulate WHAMM and the Arp2/3 complex represents a distinct strategy for membrane remodeling in which a Rab G-protein recruits the actin nucleation machinery but dampens its activity. PMID: 26823012
  12. Rab1A isoform 3 shows enhanced basal activity and is not controlled by accessory proteins PMID: 26953259
  13. Results demonstrate that ALS-mutant forms of TDP-43, FUS, and SOD1 all perturb protein transport in the early secretory pathway between ER and Golgi compartments, and imply that restoring Rab1-mediated ER-Golgi transport is a novel ALS therapeutic target PMID: 26298469
  14. Rab1A-dependent activation of mTORC1 has as role in amino acid signaling promotes growth and metastasis of hepatocellular carcinomas PMID: 26308575
  15. Overexpression of RAB1A is associated with hepatocellular carcinoma. PMID: 26023735
  16. Rab1A regulates anterograde melanosome transport by recruiting kinesin-1 to melanosomes through interaction with SKIP PMID: 25649263
  17. Rab1A knockdown induced cell death by inhibition of autophagosome formation. PMID: 24801886
  18. Vaccinia virus can be added to the growing list of viruses which require RAB1A for optimal replication, highlighting this protein as a broadly proviral host factor. PMID: 25462347
  19. hyperactive amino acid signaling through Rab1A overexpression drives oncogenesis and renders cancer cells prone to mTORC1-targeted therapy. PMID: 25446900
  20. A major biological consequence of upregulation of miR-221 is reprogramming of androgen receptor signaling via downregulation of HECTD2 and RAB1A. PMID: 23770851
  21. Rab1A can rescue the Golgi fragmentation caused by the overabundance of alpha-synuclein in nigral dopaminergic neurons, improving the ability of the surviving neurons to control motor function in hemiparkinsonian animals. PMID: 23939344
  22. These data indicate that Rab1a is an important regulator of early endosome sorting for multiple cargo species. PMID: 24407591
  23. evidence for a remarkable adaptation of SidD to its host cell target Rab1 which explains how this effector confers specificity to the reaction it catalyses. PMID: 23696742
  24. The transition state mimetic structure of the Legionella pneumophila GAP LepB in complex with Rab1, is reported. PMID: 23821544
  25. Rab1a and Rab5a preferentially bind to binary lipid compositions with higher stored curvature elastic energy. PMID: 23815289
  26. Findings show that Ypt1/Rab1 infindings show that Ypt1/Rab1 interacts with Atg1/Ulk1 in yeast and mammalian cells. PMID: 23716696
  27. analysis of APPL1 and APPL2 proteins and their interaction with Rab PMID: 23055524
  28. the potential interaction of Rab1 and its effect on export from the endoplasmic reticulum PMID: 22628317
  29. The NS5A interaction with TBC1D20 and Rab1 is essential for the viral life cycle. PMID: 22491470
  30. When bound to Rab1, LidA interfered with the covalent modification of Rab1 by phosphocholination or AMPylation, and it also blocked de-AMPylation of Rab1 by SidD and dephosphocholination by Lem3. PMID: 22228731
  31. Rab1a/b and Rab43, are important for herpes simplex virus 1 virion assembly PMID: 21680502
  32. Antibacterial autophagy occurs at omegasomes and reveal that the Rab1 GTPase plays a crucial role in mammalian autophagy. PMID: 20980813
  33. Results suggest a novel function for Rab1a in the regulation of cell migration through controlling integrin beta1 recycling and localization to lipid rafts via a specific downstream effector pathway. PMID: 20639577
  34. Studies determined the crystal structures of Legionella pneumophila SidM alone (residues 317-647) and SidM (residues 193-550) in complex with nucleotide-free WT Rab1. PMID: 20176951
  35. Results indicate that Rab1 and Rab43 are key Rabs required for the biogenesis and maintenance of a functional Golgi structure, and suggest that other Rabs acting at the Golgi complex are likely to be functionally redundant. PMID: 17684057
  36. TBC1D20 was found to be the first known GAP for Rab1, which is implicated in the regulation of anterograde traffic between the endoplasmic reticulum and the Golgi complex PMID: 17901050
  37. depletion of GM130 by RNA interference slows the rate of ER to Golgi trafficking in vivo; interactions of GM130 with syntaxin 5 and Rab1 are regulated by mitotic phosphorylation PMID: 18167358
  38. Results suggest a model where protein trafficking and neuronal differentiation are directly linked by the interaction of Rab1 and its regulator GTRAP3-18. PMID: 18363836
  39. Rab 1 S25N mutants efficiently blocked the plasma membrane trafficking of the Kir3.1/Kir3.4 complex however they did not block the Gbeta1gamma2/Kir3.1 interaction. PMID: 19135528
  40. Rab1 GTPase and dimerization modulate export traffic from the emndoplasmic reticulum to the cell surface of newly synthesized angiotensin II type 2 receptor. PMID: 19357319

Show More

Hide All

Subcellular Location
Golgi apparatus. Endoplasmic reticulum. Early endosome. Cytoplasm, cytosol. Membrane. Melanosome.
Protein Families
Small GTPase superfamily, Rab family
Database Links

HGNC: 9758

OMIM: 179508

KEGG: hsa:5861

STRING: 9606.ENSP00000387286

UniGene: Hs.310645

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*