Recombinant Human Ras-related protein Rab-23 (RAB23)

Code CSB-EP891960HU
Abbreviation Recombinant Human RAB23 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RAB23
Uniprot No.
Alternative Names
DKFZp781H0695; HSPC137; MGC8900; Rab 23; RAB family small GTP binding protein RAB 23; Rab23; RAB23; member RAS oncogene family; RAB23_HUMAN; Ras related protein Rab 23; Ras-related protein Rab-23
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-237aa
Target Protein Sequence
MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.7kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interested in several small units of many different products.  However, we are only interested in products with a GST tag.  For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag?   CSB-EP891960HU GST

A:
Thanks for your inquiry,Note: We use different codes for different tags now, so the codes of these proteins have been updated below.
5) Code: CSB-EP891960HU
Name: Recombinant Human Ras-related protein Rab-23(RAB23)
Expression Region: 1-237aa, Full Length
Tag Info: N-terminal GST-tag
Expression Sequence:

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSC


Shipping format: The default delivery form is liquid form. If the customer has demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)? With our endotoxin removal service we guarantee the endotoxin level to be
less than 0.1ng/ug (1EU ug). Both aseptic processing and endotoxin removal services are free of charge however they must be requested when the order is placed.
Purity: Greater than 90% as determined by SDS-PAGE.

Target Background

Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Together with SUFU, prevents nuclear import of GLI1, and thereby inhibits GLI1 transcription factor activity. Regulates GLI1 in differentiating chondrocytes. Likewise, regulates GLI3 proteolytic processing and modulates GLI2 and GLI3 transcription factor activity. Plays a role in autophagic vacuole assembly, and mediates defense against pathogens, such as S.aureus, by promoting their capture by autophagosomes that then merge with lysosomes.
Gene References into Functions
  1. Genetic variants in RAB23 and ANXA11 genes were associated with an increased risk of sarcoidosis-associated uveitis. PMID: 29416296
  2. miR-429 was down-regulated in hepatocellular carcinoma (HCC) tissues and cells. Up regulation of miR-429 decreased the migratory capacity and reversed the EMT to MET in HCC cells. RAB23 was confirmed as a target of miR-429. PMID: 29191386
  3. Down-regulation of Rab23 suppressed the proliferation, migration and invasion of prostate cancer cells. PMID: 28277196
  4. Rab23 serves as an important oncoprotein in human astrocytoma by regulating cell invasion and migration through Rac1 activity PMID: 26897750
  5. High Rab23 expression is associated with bladder cancer. PMID: 26715272
  6. Forced expression of MiR-92b decreased the mRNA and protein level of RAB23, and RAB23 rescued the biological functions of miR-92b. Taken together, this study revealed the oncogenic roles and the regulation of RAB23 in esophageal squamous cell carcinoma, suggesting RAB23 might be a therapeutic target PMID: 27659550
  7. Rab23 enhance squamous cell carcinoma cell invasion via up-regulating Rac1. PMID: 26648292
  8. Rab23 is expressed in breast cancer cells, and ectopic expression of Rab23 inhibits the growth and proliferation as well as induces cell apoptosis in breast cancer cells These effects may be due to the inhibition by Rab23 of Gli1 and Gli2 mRNA expression PMID: 26238143
  9. Data indicate the essential role of GTP binding protein RAB 23 (Rab23) in pancreatic ductal adenocarcinoma (PDAC) inva-sion, motility and metastasis. PMID: 25867419
  10. Rab23 was a target gene of miR-367, and ectopic expression of Rab23 could reverse the invasion and migration inhibitory activity of miR-367. PMID: 25489984
  11. The inhibition of the Rab23 cycle decreases the expression and nuclear localization of Gli1. PMID: 23007279
  12. Rab23 expression level was the highest in Bcap-37 cells. PMID: 23948406
  13. Rab9A and Rab23 GTPases play crucial roles in autophagy of Group A Streptococcus. PMID: 22452336
  14. association of the 6p12.1 locus with sarcoidosis implicates this locus as a further susceptibility factor and RAB23 as a potential signalling component PMID: 21540310
  15. Carpenter syndrome: extended RAB23 mutation spectrum and analysis of nonsense-mediated mRNA decay PMID: 21412941
  16. A RAB23 mutation (c.86dupA) present in the homozygote state in four relatives of Comorian origin with Carpenter syndrome, is reported. PMID: 20358613
  17. Rab23 is overexpressed and/or activated in hepatocellular carcinoma (HCC). Rab23 may be both a HCC predictor and a target for treating HCC. PMID: 17373734
  18. RAB23 mutations in Carpenter syndrome imply an unexpected role for hedgehog signaling in cranial-suture development. PMID: 17503333
  19. Data show that RAB23 participates in central nervous system development. PMID: 18485483
  20. RAB23 amplifications are associated with gastric cancer PMID: 18559507

Show More

Hide All

Involvement in disease
Carpenter syndrome 1 (CRPT1)
Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm. Cytoplasmic vesicle, autophagosome. Endosome membrane. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side.
Protein Families
Small GTPase superfamily, Rab family
Database Links

HGNC: 14263

OMIM: 201000

KEGG: hsa:51715

STRING: 9606.ENSP00000320413

UniGene: Hs.555016

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*