Name: Recombinant Human Ras-related protein Rab-23 (RAB23)
Brand: CUSABIO
SKU: CSB-EP891960HU

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

RAB23

Uniprot No.

Q9ULC3

Alternative Names

DKFZp781H0695; HSPC137; MGC8900; Rab 23; RAB family small GTP binding protein RAB 23; Rab23; RAB23; member RAS oncogene family; RAB23_HUMAN; Ras related protein Rab 23; Ras-related protein Rab-23

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-237aa

Target Protein Sequence

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

53.7kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-EP891960HU GST

Thanks for your inquiry，Note: We use different codes for different tags now, so the codes of these proteins have been updated below.
5) Code: CSB-EP891960HU
Name: Recombinant Human Ras-related protein Rab-23(RAB23)
Expression Region: 1-237aa, Full Length
Tag Info: N-terminal GST-tag
Expression Sequence:

Shipping format: The default delivery form is liquid form. If the customer has demand for lyophilized form, please remark this requirement when placing order.
Optional service: Do you want aseptic processing and/or endotoxin removal for this protein (recommended for cell culture or in vivo use)? With our endotoxin removal service we guarantee the endotoxin level to be
less than 0.1ng/ug (1EU ug). Both aseptic processing and endotoxin removal services are free of charge however they must be requested when the order is placed.
Purity: Greater than 90% as determined by SDS-PAGE.

Target Background

Function

The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Together with SUFU, prevents nuclear import of GLI1, and thereby inhibits GLI1 transcription factor activity. Regulates GLI1 in differentiating chondrocytes. Likewise, regulates GLI3 proteolytic processing and modulates GLI2 and GLI3 transcription factor activity. Plays a role in autophagic vacuole assembly, and mediates defense against pathogens, such as S.aureus, by promoting their capture by autophagosomes that then merge with lysosomes.

Gene References into Functions

Genetic variants in RAB23 and ANXA11 genes were associated with an increased risk of sarcoidosis-associated uveitis. PMID: 29416296
miR-429 was down-regulated in hepatocellular carcinoma (HCC) tissues and cells. Up regulation of miR-429 decreased the migratory capacity and reversed the EMT to MET in HCC cells. RAB23 was confirmed as a target of miR-429. PMID: 29191386
Down-regulation of Rab23 suppressed the proliferation, migration and invasion of prostate cancer cells. PMID: 28277196
Rab23 serves as an important oncoprotein in human astrocytoma by regulating cell invasion and migration through Rac1 activity PMID: 26897750
High Rab23 expression is associated with bladder cancer. PMID: 26715272
Forced expression of MiR-92b decreased the mRNA and protein level of RAB23, and RAB23 rescued the biological functions of miR-92b. Taken together, this study revealed the oncogenic roles and the regulation of RAB23 in esophageal squamous cell carcinoma, suggesting RAB23 might be a therapeutic target PMID: 27659550
Rab23 enhance squamous cell carcinoma cell invasion via up-regulating Rac1. PMID: 26648292
Rab23 is expressed in breast cancer cells, and ectopic expression of Rab23 inhibits the growth and proliferation as well as induces cell apoptosis in breast cancer cells These effects may be due to the inhibition by Rab23 of Gli1 and Gli2 mRNA expression PMID: 26238143
Data indicate the essential role of GTP binding protein RAB 23 (Rab23) in pancreatic ductal adenocarcinoma (PDAC) inva-sion, motility and metastasis. PMID: 25867419
Rab23 was a target gene of miR-367, and ectopic expression of Rab23 could reverse the invasion and migration inhibitory activity of miR-367. PMID: 25489984
The inhibition of the Rab23 cycle decreases the expression and nuclear localization of Gli1. PMID: 23007279
Rab23 expression level was the highest in Bcap-37 cells. PMID: 23948406
Rab9A and Rab23 GTPases play crucial roles in autophagy of Group A Streptococcus. PMID: 22452336
association of the 6p12.1 locus with sarcoidosis implicates this locus as a further susceptibility factor and RAB23 as a potential signalling component PMID: 21540310
Carpenter syndrome: extended RAB23 mutation spectrum and analysis of nonsense-mediated mRNA decay PMID: 21412941
A RAB23 mutation (c.86dupA) present in the homozygote state in four relatives of Comorian origin with Carpenter syndrome, is reported. PMID: 20358613
Rab23 is overexpressed and/or activated in hepatocellular carcinoma (HCC). Rab23 may be both a HCC predictor and a target for treating HCC. PMID: 17373734
RAB23 mutations in Carpenter syndrome imply an unexpected role for hedgehog signaling in cranial-suture development. PMID: 17503333
Data show that RAB23 participates in central nervous system development. PMID: 18485483
RAB23 amplifications are associated with gastric cancer PMID: 18559507

Hide All

Involvement in disease

Carpenter syndrome 1 (CRPT1)

Subcellular Location

Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm. Cytoplasmic vesicle, autophagosome. Endosome membrane. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side.

Protein Families

Small GTPase superfamily, Rab family

Database Links

HGNC: 14263

OMIM: 201000

KEGG: hsa:51715

STRING: 9606.ENSP00000320413

UniGene: Hs.555016

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address