Recombinant Human Regenerating islet-derived protein 3-alpha (REG3A)

In Stock
Code CSB-EP019548HU
Abbreviation Recombinant Human REG3A protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
REG3A
Uniprot No.
Research Area
Immunology
Alternative Names
FLJ18565; Hepatocarcinoma intestine pancreas; Hepatointestinal pancreatic protein; HIP; HIP/PAP; Human proislet peptide; INGAP; Pancreatic beta cell growth factor; Pancreatitis associated protein 1; Pancreatitis associated protein; Pancreatitis-associated protein 1; PAP; PAP H; PAP homologous protein; PAP1; PBCGF; Proliferation inducing protein 34; Proliferation inducing protein 42; Reg III alpha; REG III; Reg III-alpha; REG-3-alpha; REG3; Reg3a; REG3A_HUMAN; Regenerating islet derived 3 alpha; Regenerating islet derived protein 3 alpha precursor; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein III-alpha
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
27-175aa
Target Protein Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Presenting our premium Recombinant Human REG3A protein, also known as Regenerating islet-derived protein 3-alpha (REG-3-alpha), a crucial component for advancing research in the field of immunology. REG3A is a C-type lectin protein that displays antibacterial activity and plays a vital role in the innate immune response, particularly in the pancreas and gastrointestinal tract.

Our Recombinant Human REG3A protein is expressed in E.coli, ensuring the full length of the mature protein (27-175aa) is obtained. The N-terminal GST-tag allows for efficient purification while preserving the protein's native structure and function. With a purity greater than 90% as determined by SDS-PAGE, our REG3A protein guarantees consistent and reliable results in your research applications. Available in both liquid and lyophilized powder forms, our Recombinant Human REG3A protein is ready to support your scientific endeavors.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Regulates keratinocyte proliferation and differentiation after skin injury via activation of EXTL3-PI3K-AKT signaling pathway.
Gene References into Functions
  1. Data show that regenerating family member 3 alpha protein (REG3A) can modulate specific cutaneous inflammatory responses and that the decrease in cutaneous REG3A exacerbates toll-like receptor 3 (TLR3)-mediated inflammation in diabetic skin wounds. PMID: 27830702
  2. Data found that REG3A was significantly downregulated in Gastric cancer and closely related with patient prognoses. REG3A overexpression suppressed the invasion and proliferation promoting apoptosis of GC cells. While REG3A knockdown promoted the invasion, and proliferation suppressing PMID: 29512686
  3. Mice with hepatocytes that express hREG3A, which travels to the intestinal lumen, are less sensitive to colitis than control mice. Suggest reduced oxidative stress preserves the gut microbiota and its ability to prevent inflammation. PMID: 29133078
  4. The pancreas reacts to remote lesions and septic insults in mice and rats with increased PSP synthesis, while PAP is selectively responsive to septic events. Furthermore, our results suggest that serum PSP in septic patients is predominantly derived through an acute phase response of the pancreas. PMID: 28415799
  5. Data show that interleukin-2 receptor alpha, tumor necrosis factor receptor 1, serum STimulation-2 (IL1RL1 gene product), and regenerating islet-derived 3-alpha were significantly associated with non-relapse mortality. PMID: 28126963
  6. skin injury increases IL-36gamma via the activation of TLR3-SLUG-VDR axis and IL-36gamma induces REG3A to promote wound healing PMID: 28774595
  7. Association between a SNP in the REG3A gene, rs7588571, located upstream of the REG3A gene, and bone marrow transplant outcomes including the incidence of chronic GVHD. Since REG proteins control intestinal microbiota, and since intestinal dysbiosis is in part responsible for the development of GVHD, findings lead to the concept that REG3A could have some protective effect through the regulation of gut microbiota. PMID: 28945764
  8. Patients with high levels of PAP/REG3A had overall shorter survival as well as poor surgical outcomes with reduced disease-free survival. PMID: 28656348
  9. Serum REG3alpha is not an accurate diagnostic and predictive biomarker in Crohn's disease patients undergoing hemopoetic stem cell transplantation. PMID: 26278889
  10. Up-regulation of REG3A correlates with colorectal cancer risk. PMID: 26646797
  11. Regulation network analysis confirmed the cell growth related differentially expressed genes, and further uncovered three transcription factor families with immune functions regulated by REG3A PMID: 26719042
  12. Reg3alpha is an extracellular matrix-targeted reactive oxygen species scavenger that binds the fibrin scaffold resulting from hepatocyte death during acute liver failure. PMID: 25938566
  13. our findings reveal a dual and contextual pathophysiologic role for REG3beta during pancreatitis and pancreatic ductal adenocarcinoma initiation PMID: 26404002
  14. Reg3A overexpression promoted cell growth in pancreatic cancer. SOCS3 is a key target in cancer by inhibiting cell growth and inducing apoptosis. SOCS3 negatively regulated Reg3A-mediated cell growth in pancreatic cancer. PMID: 24996521
  15. Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing PMID: 25751817
  16. Serum regenerating islet-derived 3-alpha is a biomarker of mucosal enteropathies PMID: 25112824
  17. Both live and heat-inactivated Bifidobacterium breve induced the expression of REGIII-alpha, the human ortholog and homolog of REGIII-gamma, in human colonic epithelial cells (Caco-2). PMID: 24096422
  18. Cells transfected with REG III exhibited significantly lower cell proliferation. PMID: 23743605
  19. human RegIIIalpha (also known as HIP/PAP) binds membrane phospholipids and kills bacteria by forming a hexameric membrane-permeabilizing oligomeric pore PMID: 24256734
  20. The INGAP-pp may facilitate the differentiation of hUCMSCs into IPCs. However, the IPCs are not as mature as normal human islet beta cells. PMID: 23388332
  21. Immunohistochemistry against known cell-type markers on serial sections has localised the expression of REGs to metaplastic Paneth cells (REG1A, REG1B and REG3A) and enteroendocrine cells (REG4), with a marked expansion of expression during inflammation. PMID: 23519454
  22. HIP/PAP was abundantly expressed in bladder cancer, and the urinary levels of HIP/PAP could be a novel biomarker for detection of bladder cancer. PMID: 22943287
  23. REG3A may mediate the epidermal hyperproliferation observed in normal wound repair and in psoriasis. PMID: 22727489
  24. Immunoreactivity to INGAP localized to the pancreatic endocrine cells in mouse. INGAP and/or related group 3 Reg proteins have a conserved expression in the pancreatic islet. PMID: 17998566
  25. Data suggest that PAP I may contribute to endogenous protective mechanisms relevant under harmful conditions like oxidative stress, brain injury, or neurodegeneration. PMID: 21643999
  26. The Reg3a can serve as novel target in diabetes mellitus genetic therapy. PMID: 20536387
  27. HIP/PAP recognizes the cell wall peptidoglycan carbohydrate backbone in a calcium-independent manner via a conserved "EPN" motif that is critical for bacterial killing. PMID: 20382864
  28. HIP/PAP stimulates liver regeneration after partial hepatectomy and combines mitogenic and anti-apoptotic functions through the protein kinase A signaling pathway. PMID: 12890698
  29. In transgenic mice, HIP/PAP is a promising candidate for the prevention and treatment of liver failure. PMID: 16116631
  30. findings show that RegIIIgamma and its human counterpart, HIP/PAP, are directly antimicrobial proteins that bind their bacterial targets via interactions with peptidoglycan carbohydrate PMID: 16931762
  31. human pancreatitis-associated protein fibrillization is initiated by protein aggregation primarily because of electrostatic interactions PMID: 16963458
  32. INGAP and/or related group 3 Reg proteins have a conserved expression in the pancreatic islet. PMID: 17998566
  33. PAP mRNA expression and serum PAP levels are closely related to neoplastic proliferative activity in patients with colorectal carcinoma. PMID: 19051257
  34. PAP diminished the expression of MMP-1 and -2 and TIMP-1 and -2 and their concentrations in pancreatic stellate cell supernatants. RECK was detected on the surface of PSCs and its expression was reduced after PAP application PMID: 19077460
  35. antibacterial activities of mouse RegIIIgamma and its human ortholog, HIP/PAP, are tightly controlled by an inhibitory N-terminal prosegment that is removed by trypsin in vivo. PMID: 19095652
  36. HIP enhanced EXTL3 translocation from the membrane to the nucleus, in support of a model whereby EXTL3 mediates HIP signaling for islet neogenesis. PMID: 19158046
  37. N-terminal processing is necessary for the peptidoglycan binding and bacteria-aggregating activity of PAP and that trypsin-processed and elastase-processed forms are functionally equivalent. PMID: 19254208

Show More

Hide All

Subcellular Location
Secreted. Note=Found in the apical region of pancreatic acinar cells.
Tissue Specificity
Highly expressed in epidermal keratinocytes of psoriasis patients (at protein level). Constitutively expressed in intestine. Low expression is found in healthy pancreas. Overexpressed during the acute phase of pancreatitis and in some patients with chroni
Database Links

HGNC: 8601

OMIM: 167805

KEGG: hsa:5068

STRING: 9606.ENSP00000304311

UniGene: Hs.567312

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*