Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
FLJ18565; Hepatocarcinoma intestine pancreas; Hepatointestinal pancreatic protein; HIP; HIP/PAP; Human proislet peptide; INGAP; Pancreatic beta cell growth factor; Pancreatitis associated protein 1; Pancreatitis associated protein; Pancreatitis-associated protein 1; PAP; PAP H; PAP homologous protein; PAP1; PBCGF; Proliferation inducing protein 34; Proliferation inducing protein 42; Reg III alpha; REG III; Reg III-alpha; REG-3-alpha; REG3; Reg3a; REG3A_HUMAN; Regenerating islet derived 3 alpha; Regenerating islet derived protein 3 alpha precursor; Regenerating islet-derived protein 3-alpha 15 kDa form; Regenerating islet-derived protein III-alpha
Species
Homo sapiens (Human)
Expression Region
27-175aa
Target Protein Sequence
EEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Presenting our premium Recombinant Human REG3A protein, also known as Regenerating islet-derived protein 3-alpha (REG-3-alpha), a crucial component for advancing research in the field of immunology. REG3A is a C-type lectin protein that displays antibacterial activity and plays a vital role in the innate immune response, particularly in the pancreas and gastrointestinal tract.
Our Recombinant Human REG3A protein is expressed in E.coli, ensuring the full length of the mature protein (27-175aa) is obtained. The N-terminal GST-tag allows for efficient purification while preserving the protein's native structure and function. With a purity greater than 90% as determined by SDS-PAGE, our REG3A protein guarantees consistent and reliable results in your research applications. Available in both liquid and lyophilized powder forms, our Recombinant Human REG3A protein is ready to support your scientific endeavors.
