Recombinant Human Regulator of G-protein signaling 20 (RGS20)

Code CSB-YP019652HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP019652HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP019652HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP019652HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
RGS20
Uniprot No.
Alternative Names
G(z)GAP; Gz selective GTPase activating protein; Gz-GAP; Gz-selective GTPase-activating protein; HGNC:14600; Regulator of G protein signaling 20; Regulator of G-protein signaling 20; Regulator of G-protein signaling Z1; Regulator of Gz selective protein signaling 1; Regulator of Gz-selective protein signaling 1; RGS20; RGS20_HUMAN; RGSZ1; ZGAP1
Species
Homo sapiens (Human)
Expression Region
1-234aa
Target Protein Sequence
EPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Protein Length
Full length of BC015614
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins.
Gene References into Functions
  1. NEAT1 silencing also inhibited tumor growth in vivo. Collectively, we revealed that the NEAT1/miR365/RGS20 axis may be a novel mechanism or therapeutic strategy for OSCC treatment. PMID: 29484420
  2. Data suggest that Gpr176 (G-protein coupled receptor 176) is an SCN-(suprachiasmatic nucleus-)enriched orphan GPCR (G-protein-coupled receptor) that sets the pace of circadian behavior; a unique cAMP-repressing G-protein subclass Gz is required for the activity of Gpr176. [REVIEW] PMID: 28502923
  3. These results suggest that the expression of RGS20 may promote metastasis of tumor cells. PMID: 27495875
  4. Findings suggest that high regulator of G protein signaling 20 (RGS20) expression is associated with unfavorable survival in triple-negative breast cancer (TNBC). PMID: 28237701
  5. provide new evidence that RGSZ1 interacts not only with Galpha(z,) but also with Galpha(i), as supported by in vitro binding assays and functional studies PMID: 12379657
  6. NMR study PMID: 14872136
  7. The major function of PKCI-1 is to modulate mu opioid receptor signaling pathway along with RGSZ1, rather than directly mediating the Galphaz RGSZ1 interaction. PMID: 17126529

Show More

Hide All

Subcellular Location
Membrane; Lipid-anchor. Nucleus. Cytoplasm.
Tissue Specificity
Isoform 5 is expressed in brain at high levels in the caudate nucleus and temporal lobe.
Database Links

HGNC: 14600

OMIM: 607193

KEGG: hsa:8601

STRING: 9606.ENSP00000297313

UniGene: Hs.368733

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×