Recombinant Human Regulator of G-protein signaling 20(RGS20)

Code CSB-EP019652HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O76081
Relevance Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Gz-selective GTPase-activating protein
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Research Area Signal Transduction
Source E.coli
Gene Names RGS20
Protein Names Recommended name: Regulator of G-protein signaling 20 Short name= RGS20Alternative name(s): Gz-selective GTPase-activating protein Short name= G(z)GAP Short name= Gz-GAP Regulator of G-protein signaling Z1 Regulator of Gz-sel
Expression Region 1-234aa
Tag Info N-terminal GST-tagged
Mol. Weight 53.4kDa
Protein Description Full Length of BC015614
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins (By similarity).
Subcellular Location Membrane, Lipid-anchor, Nucleus, Cytoplasm
Tissue Specificity Isoform 5 is expressed in brain at high levels in the caudate nucleus and temporal lobe.
Database Links

HGNC: 14600

OMIM: 607193

KEGG: hsa:8601

STRING: 9606.ENSP00000297313

UniGene: Hs.368733

Related Products

RGS20 Antibodies

RGS20 Antibodies for Homo sapiens (Human)

RGS20 Antibodies for Human

RGS20 Proteins

RGS20 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.