Recombinant Human Replication factor C subunit 1(RFC1), partial

Code CSB-BP019588HU
Product Type Recombinant Protein
Size US$294
Uniprot No. P35251
Relevance The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA. Interacts with C-terminus of PCNA. 5' phosphate residue is required for binding of the N-terminal DNA-binding domain to duplex DNA, suggesting a role in recognition of non-primer template DNA structures during replication and/or repair.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
Research Area Epigenetics and Nuclear Signaling
Source Baculovirus
Gene Names RFC1
Protein Names Activator 1 140 kDa subunit
Expression Region 402-492aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 13.8 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.
Subcellular Location Nucleus
Protein Families Activator 1 large subunit family
Tissue Specificity Wide tissue distribution. Undetectable in placental tissue.
Database Links

HGNC: 9969

OMIM: 102579

KEGG: hsa:5981

STRING: 9606.ENSP00000371321

UniGene: Hs.507475

Pathway DNA repair pathway

Related Products

RFC1 Antibodies

RFC1 Antibodies for Homo sapiens (Human)

RFC1 Antibodies for Arabidopsis thaliana (Mouse-ear cress)

RFC1 Antibodies for Oryza sativa subsp. japonica (Rice)

RFC1 Antibodies for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

RFC1 Antibodies for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

RFC1 Proteins

RFC1 Proteins for Homo sapiens (Human)

RFC1 Proteins for Mus musculus (Mouse)

RFC1 Proteins for Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

RFC1 Proteins for Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

RFC1 Proteins for Dictyostelium discoideum (Slime mold)

RFC1 cDNA

RFC1 cDNA for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.