Recombinant Human Replication factor C subunit 1(RFC1),partial

Code CSB-YP019588HU
Size US$1916
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names RFC1
Uniprot No. P35251
Research Area Epigenetics and Nuclear Signaling
Alternative Names A1 140 kDa subunit; A1; A1 P145 Activator 1 large subunit; Activator 1 140 kDa subunit; Activator 1 large subunit; Activator 1 subunit 1; DNA binding Protein PO GA; DNA-binding protein PO-GA; MHC binding factor beta; MHCBFB; PO GA; RECC1; Replication factor C (activator 1) 1, 145kDa; Replication factor C 140 kDa subunit; Replication factor C; Replication factor C large subunit; Replication factor C subunit 1; Replication factor C1; RF-C 140 kDa subunit; RFC; RFC1; RFC1_HUMAN; RFC140; RFC140 Replication Factor C 140 kDa subunit
Species Homo sapiens (Human)
Source Yeast
Expression Region 402-492aa
Target Protein Sequence GAENCLEGLIFVITGVLESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIRTMPGKKSKYEIA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 11.8 kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins PCNA and activator 1. This subunit binds to the primer-template junction. Binds the PO-B transcription element as well as other GA rich DNA sequences. Could play a role in DNA transcription regulation as well as DNA replication and/or repair. Can bind single- or double-stranded DNA.
Gene References into Functions
  1. Human CTF18-RFC clamp-loader complexed with non-synthesising POLE efficiently loads the PCNA sliding clamp. PMID: 28199690
  2. RFC depletion had a negative impact on LANA's ability to replicate and maintain viral DNA in cells containing artificial KSHV episomes or in infected cells, leading to loss of virus. PMID: 25071216
  3. phosphorylation of serine 51 on hLigI plays a critical role in regulating the interaction between hLigI and RFC, which is required for efficient DNA replication and repair. PMID: 22952233
  4. report that the large subunit (RFC1) of replication factor C is cleaved in Hutchinson-Gilford progeria syndrome cells, leading to the production of a truncated RFC1 of ~ 75 kDa PMID: 22168243
  5. We identified a variant in each of 3 genes (RFC1, SCN1A, ANPEP) potentially implicated in susceptibility to severe neurological complications in West Nile Virus disease. PMID: 21881118
  6. Small interfering RNA-mediated knockdown of RFC1 impairs upstream removal of UV lesions and abrogates the downstream recruitment of DNA polymerase delta. PMID: 20713449
  7. analysis of the DNA-bound BRCA1 C-terminal region structure from human replication factor C p140 and model of the protein-DNA complex PMID: 20081198
  8. interaction with histone deacetylase HDAC1 PMID: 12045192
  9. RFC (p140) has an important role as a regulator of transcription and NF-kappaB activity PMID: 12509469
  10. destabilization of the RF-C complex by CDKs may inactivate the RF-C complex at the end of S phase PMID: 12947101
  11. NMR resonance assignments of the BRCT region of the large subunit PMID: 15772763
  12. Ctf18-RFC interacts physically with pol eta, which allows DNA replication forks to overcome interference by various template structures, including damaged DNA and DNA-protein complexes that maintain chromosome cohesion PMID: 17545166
  13. Data show that replication factor C (RFC), via several stimulatory motifs per molecule, potently activates flap endonuclease 1 (FEN1), making RFC a critical partner with FEN1 for the processing of eukaryotic Okazaki fragments. PMID: 19208620
  14. a mutant version of hLigI, which mimics the hyperphosphorylated M-phase form of hLigI, does not interact with and is not inhibited by RFC, demonstrating that inhibition of ligation is dependent upon the interaction between hLigI and RFC PMID: 19223468

Show More

Hide All

Subcellular Location Nucleus
Protein Families Activator 1 large subunit family
Tissue Specificity Wide tissue distribution. Undetectable in placental tissue.
Database Links

HGNC: 9969

OMIM: 102579

KEGG: hsa:5981

STRING: 9606.ENSP00000371321

UniGene: Hs.507475

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1