Recombinant Human Resistin (RETN)

Code CSB-EP019573HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RETN
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Adipose tissue specific secretory factor; Adipose tissue-specific secretory factor; ADSF; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein; C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 1; C/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; CG5403; Cysteine rich secreted protein A12 alpha like 2; Cysteine rich secreted protein FIZZ3; Cysteine-rich secreted protein A12-alpha-like 2; Cysteine-rich secreted protein FIZZ3; dri; FIZZ 3; FIZZ3; Found in inflammatory zone 3 ; HXCP 1; HXCP1; MGC126603; MGC126609; PRO1199; Resistin; Resistin delta2; RETN 1; RETN; RETN_HUMAN; RETN1; RSTN; UNQ407; XCP 1; XCP1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-108aa
Target Protein Sequence
KTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
25.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Explore the potential of our Recombinant Human RETN protein, a critical component for cardiovascular research. Resistin, also known as Adipose tissue-specific secretory factor (ADSF), is a hormone involved in glucose homeostasis and insulin resistance, making it a relevant target in the study of obesity, diabetes, and cardiovascular diseases.

Our Recombinant Human RETN protein is expressed in E.coli, yielding a partial protein length (19-108aa) while preserving its biological activity. The N-terminal GST-tag facilitates efficient purification without compromising the protein's functionality. With a purity greater than 90% as determined by SDS-PAGE, our RETN protein ensures consistent and dependable results for your research endeavors. Available in both liquid and lyophilized powder forms, our Recombinant Human RETN protein is ready to enhance your scientific discoveries.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hormone that seems to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes. Promotes chemotaxis in myeloid cells.
Gene References into Functions
  1. The results of this study indicated that resistin gene polymorphisms might affect the genetic predisposition of rheumatoid arthritis in Chinese population. PMID: 29978502
  2. It was demonstrated that high resistin expression was predominantly observed in lung adenocarcinoma tissues. It is associated with a more malignant clinicopathological status and poorer survival. Resistin could promote A549 and H1975 tumor cell proliferation, migration and invasion while inhibit their apoptosis in vitro. PMID: 30272365
  3. A multi-cytokine resistin pathway is operational in humans, and it plays a substantial role in cardiovascular events in high-risk individuals. PMID: 28290549
  4. An increase in resistin concentration expressed also as resistin/BMI, and resistin/adiponectin ratios, observed in children with cystic fibrosis may suggests that this adipokine is involved in the inflammatory process underlying the disease and is related to worse spirometric parameters describing airways obstruction. PMID: 29465158
  5. n T2 mice, the mRNA expression of Retn showed a moderate up-regulation (fold change=8.32; p=0.0019) in the adipose tissues. Iapp expression was also significantly up-regulated (fold change=9.78; p=0.012). Moreover, a 6.36-fold up-regulation for Drd5 was observed in the adipose tissues of T2 mice PMID: 29936463
  6. RETN and CAP1 polymorphisms and gene expression may be potential biomarkers for breast cancer risk PMID: 29641286
  7. resistin induced MUC5AC and MUC5B expression via activation of different signaling pathways in human airway epithelial cells. PMID: 29604272
  8. Study provides clear evidence that resistin is a clinically relevant endogenous ligand for TLR4, which promotes tumor progression via TLR4/NF-kappaB/STAT3 signaling. PMID: 28991224
  9. women with gestational diabetes showed significantly low adiponectin and high resistin levels when compared with control group. PMID: 29207892
  10. increased levels of resistin in erosive and non-erosive hand osteoarthritis PMID: 29105498
  11. Resistin promotes a shift from proliferation to apoptosis in vascular smooth muscle cells and macrophage co-culture systems with cellular composition similar to that found in vulnerable regions of plaques. PMID: 29361366
  12. The inverse association between serum resistin and n-3 PUFA intake was strongest in SNP-420 G/G genotype in the Japanese cohort. PMID: 29044636
  13. Our results do not support a relationship among resistin levels, obesity and insulin resistance in humans PMID: 29280648
  14. rs1862513 and rs3745368 in resistin genes are not associated with the presence of MetS in a Han Chinese population. PMID: 29386698
  15. For T2D, when the subjects were separated by resistin into tertiles, elevated resistin was associated with a benefit for the Castelli 1 index PMID: 28760596
  16. The -420C>G resistin gene polymorphism appears to be associated with more severe stroke and higher in-hospital mortality in patients with acute ischemic stroke. Higher leptin levels appear to be related to favorable functional outcome. PMID: 29217361
  17. Resistin contributes to the pathogenesis of rheumatoid arthritis by increasing chemokine production by fibroblast-like synoviocytes PMID: 29191223
  18. Studies identify a critical role for hRetn in blocking lipopolysaccharide function with important clinical significance in helminth-induced immunomodulation and sepsis. PMID: 29133417
  19. Plasma resistin did not show any association with the degree of vascular damage in non-hypersomnolent obstructive sleep apnoea patients. PMID: 27256793
  20. In anorexia nervosa subjects, GG genotype of RETN c.-180 was significantly more frequent than in control group. PMID: 28759190
  21. serum and follicular fluid resistin levels were significantly higher in the endometriosis group PMID: 29442466
  22. Our data suggest that adiponectin and resistin are altered in non-obese chronic migraineurs. PMID: 27553954
  23. Studied the association of resistin (RETN); single nucleotide polymorphisms (SNPs) and serum RETN levels in obese and non-obese Tunisians. PMID: 28393393
  24. This study has shown Resistin, and Visfatin synergistically increased gastric cancer cell proliferation and enhanced the telomerase gene expression, showing that these two hormones in gastric cancer tissue could cooperatively accelerate cancer cell growth PMID: 29228527
  25. resistin is differentially expressed in endometrial tissues from women with endometriosis and imply a role for resistin in endometriosis-associated pelvic inflammation PMID: 28681517
  26. Resistin, but not copeptin levels are higher in acute ischemic stroke patients early after the stroke onset, than in age and gender matched stroke-free controls. Moreover, higher copeptin concentrations are predictive of poor short term functional outcome after ischemic stroke PMID: 28845746
  27. Significant up-regulation of PBMCs CAP1, CD36 mRNA and plasma resistin found in significant coronary artery disease, as well as in nonsignificant coronary artery disease compared to control group, indicates that resistin could be able to exert its effects stronger on cells with up-regulated CAP1 mRNA thus contributing atherosclerosis development. PMID: 28707728
  28. Results demonstrate an association between RETN gene variants and risk of rheumatoid arthritis disease. RETN SNPs were significantly associated with clinical therapies and C-reactive protein serum marker of rheumatoid arthritis in the Chinese Han population. PMID: 29561430
  29. Studied adiponectin (ADIPOQ), leptin (LEP), leptin receptor (LEPR), and resistin (RETN) single nucleotide polymorphisms and their association in obesity. Results showed that ADIPOQ 4522CPMID: 28195351
  30. Results show that adiponectin, resistin and visfatin are present in osteophytes but have no direct influence on osteophyte development. Although these adipokines induce several inflammatory mediators, they do not affect osteoblast- or chondrocyte-related mechanisms of osteophyte development. PMID: 27884778
  31. Fine-tuned by RETN SNPs, intrahepatic, multi-cellular resistin reinforced IFNL3 in eliminating HCV via immunomodulation to counteract pro-inflammation. PMID: 27477870
  32. Dementia of vascular origin is characterized by elevated resistin levels. PMID: 28421328
  33. Resistin probably plays a role in the pathogenesis of hepatic insulin resistance and aggravates pathologic changes in the liver of patients with non-alcoholic fatty liver disease PMID: 29363914
  34. Resistin and NGAL correlate with expression of endothelial cell adhesion molecules in sepsis. PMID: 28424824
  35. the role of resistin (an adipokine) in the development of gestational diabetes mellitus PMID: 28685604
  36. high resistin levels are associated with increased obesity-related cancer risk [meta-analysis] PMID: 27509174
  37. Results showed that the RETN SNP rs3219175 with AG or at least 1 A allele was associated with a higher risk of lung cancer than wild-type (GG) carriers. Moreover, the RETN SNP rs3219175 with AG or AG + AA alleles was associated with a higher risk of distant metastasis than that in patients carrying GG alleles. PMID: 29384942
  38. Report decreased serum resistin level in Grave's disease patients. Suggest that serum resistin is primarily secreted from circulating neutrophils and down-regulated by excessive thyroid hormones in GD patients. PMID: 27637079
  39. Change in salivary resistin level was not significantly associated with periodontal outcomes. In obese Malaysians, NSPT significantly improved PS and GBI, and improved PPD and CAL for shallow and moderately deep pockets but not for deep pockets PMID: 28049964
  40. Therefore, rs1423096 and rs10401670, in addition to SNP-420 and SNP-358, were identified as possible functional variants affecting circulating resistin by the genome-wide search in the Japanese population. PMID: 27664181
  41. In this meta-analysis, serum resistin levels are associated with and increased risk of acute cerebral infarction in Asians, but not in Caucasians. PMID: 26899574
  42. the mutant genotype of two SNPs of the RETN gene (rs1862513 and rs10401670) was associated with a lack of change in resistin secondary to biliopancreatic diversion PMID: 27118275
  43. Serum resistin level was higher in CKD ( Chronic Kidney Diseases ) patients compared to control subjects. PMID: 25385911
  44. The present study suggests that the G/G genotype of RETN rs1862513 could be a predictor of the reduction of HOMA-IR, insulin, fasting glucose and LDL cholesterol secondary to a hypocaloric diet in obese subjects. PMID: 28064279
  45. The serum levels of IL-8, MIP-1 alpha, MIP-1 beta, MMP-8, Resistin, FLRG, and BCAM were significantly higher in breast cancer patients, but LAP and TSH-beta levels were lower. PMID: 26898119
  46. Results provide evidence that RETN SNPs were functional and associated with the levels of serum creatinine and cholesterol. PMID: 29101068
  47. Resistin-associated VSMC dysfunction and intimal hyperplasia are related to PKCepsilon-dependent Nox activation and ROS generation PMID: 27573736
  48. Adiponectin and resistin show an additive independent effect on all-cause mortality in patients with type 2 diabetes PMID: 27175608
  49. Amendment of the cytokine profile in macrophages subsequent to their interaction with smooth muscle cells: Differential modulation by fractalkine and resistin. PMID: 27180200
  50. The strongest OR was for CXCL8 (interleukin-8) in serum (96.8, 95% CI: 11.9-790.2). Of these 15 markers, 6 were also significantly elevated in serum from Chile (CCL20, C-reactive protein, CXCL8, CXCL10, resistin, serum amyloid A). PMID: 27173614

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Resistin/FIZZ family
Tissue Specificity
Expressed in white adipose tissue (at protein level). Widely expressed, with particularly strong expression in lung, bone marrow, breast and peripheral blood. Expressed strongly in bone marrow and at lower levels in lung, but not detected in other tissues
Database Links

HGNC: 20389

OMIM: 605565

KEGG: hsa:56729

STRING: 9606.ENSP00000221515

UniGene: Hs.283091

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*