| Code | CSB-YP618980HU | 
| Abbreviation | Recombinant Human RCN1 protein, partial | 
| MSDS | |
| Size | $250 | 
| Order now | |
| Image | 
                
  | 
            
| Have Questions? | Leave a Message or Start an on-line Chat | 
There are currently no reviews for this product.
We are interested in several small units of many different products. However, we are only interested in products with a GST tag. For those listed below that have a His tag, what is the expense and time associated with getting these in a GST tag? CSB-YP618980HU His
PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL