Recombinant Human Reticulocalbin-1 (RCN1)

Code CSB-EP618980HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP618980HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP618980HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP618980HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
RCN1
Uniprot No.
Research Area
Neuroscience
Alternative Names
Epididymis secretory protein Li 84; FLJ37041; HEL S 84; PIG20; Proliferation inducing gene 20; RCAL; RCN 1; RCN; rcn1; RCN1_HUMAN; Reticulocalbin 1; Reticulocalbin 1 EF hand calcium binding domain; Reticulocalbin-1; Reticulocalbin1
Species
Homo sapiens (Human)
Expression Region
31-331aa
Target Protein Sequence
PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL
Mol. Weight
37.7kD
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.
Gene References into Functions
  1. RCN1 may promote cell survival and serve as a useful target for cancer therapy. PMID: 29453900
  2. irradiated tumor cells were observed to significantly up-regulate the expression of calcium-binding proteins CALM1, CALU, and RCN1, suggesting important roles for these mediators in promoting tumor cell survival during hypoxia PMID: 27790916
  3. RCN1 expression was not statistically significantly different to healthy controls but was associated with disease activity score and could be used as a stratification biomarker for systemic sclerosis patients. PMID: 27468573
  4. reticulocalbin-1 plays a key role in the development of doxorubicin-associated resistance PMID: 25242635
  5. Ca(2+) binding caused an increase in the alpha-helix content of human RCN1. On the other hand, RCN1 did not change the structure with Mg. PMID: 24451493
  6. a promising role of RCN1 as a possible marker in Renal cell carcinoma PMID: 23916412
  7. reticulocalbin-1 may be an important molecule in understanding lymphatic endothelial cells in tumors function and control of lymphatic metastasis. PMID: 21272564
  8. Increased RCN1 is associated with systemic sclerosis and nephrogenic systemic fibrosis. PMID: 20724591
  9. deletion of Rcn1 directly or indirectly contributes to the eye phenotype in Pax6 contiguous gene deletions PMID: 19474196
  10. RCN1 also is expressed on the cell surface of several endothelial cell lines, including human dermal microvascular endothelial cells (HDMVECs), bone marrow endothelial cells (BMEC), and transformed human bone marrow endothelial cells (TrHBMEC). PMID: 18561328
  11. Data show that calumenin in the presence of calcium binds specifically to thrombospondin-1, but closely-related reticulocalbin does not form a similar complex. PMID: 18688696

Show More

Hide All

Subcellular Location
Endoplasmic reticulum lumen.
Protein Families
CREC family
Database Links

HGNC: 9934

OMIM: 602735

KEGG: hsa:5954

STRING: 9606.ENSP00000054950

UniGene: Hs.97887

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×