Recombinant Human Retinal dehydrogenase 2 (ALDH1A2)

In Stock
Code CSB-YP001566HU
Abbreviation Recombinant Human ALDH1A2 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
AL1A2_HUMAN; Aldehyde dehydrogenase family 1 member A2; ALDH1A2 aldehyde dehydrogenase 1 family; member A2 ; ALDH1A2; Aldh1a7; AV116159; MGC26444; RALDH 2; RALDH(II); Raldh1; RalDH2; RALDH2 T; Retinal dehydrogenase 2; Retinaldehyde dehydrogenase 2 ; Retinaldehyde specific dehydrogenase type 2; Retinaldehyde-specific dehydrogenase type 2
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-518aa
Target Protein Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEAGFPPGVINILPGYGPTAGAAIASHIGIDKIAFTGSTEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
58.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Recombinant Human ALDH1A2 protein is a critical tool for neuroscience research. Retinal dehydrogenase 2 (RALDH 2; RalDH2) is an essential enzyme involved in the synthesis of retinoic acid, a crucial signaling molecule that modulates gene expression during embryonic development and adult tissue homeostasis. ALDH1A2 has been implicated in neuronal development and differentiation, making it a key target for advancing our understanding of the nervous system.

Our Recombinant Human ALDH1A2 protein is expressed in yeast, ensuring optimal post-translational modifications and folding, while maintaining a full-length protein sequence (1-518aa). The N-terminal 6xHis-tag facilitates efficient purification without affecting the protein's functionality. With a purity greater than 90% as determined by SDS-PAGE, our ALDH1A2 protein guarantees reliable and consistent results for your research projects. Available in both liquid and lyophilized powder forms, our Recombinant Human ALDH1A2 protein is poised to advance your scientific discoveries.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Converts retinaldehyde to retinoic acid. Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Can metabolize octanal and decanal, but has only very low activity with benzaldehyde, acetaldehyde and propanal. Displays complete lack of activity with citral.
Gene References into Functions
  1. The authors findings indicate that the SNP rs4238326 in ALDH1A2 gene may potentially modify individual susceptibility to knee OA in the Chinese population. PMID: 28089900
  2. high transcription activities of ALDH1A2, ALDH1A3 and ALDH1L1 predicted worsen overall survival in gastric cancer patients PMID: 27015121
  3. Data show that hRALDH2 is not inhibited by its oxidation product, all-trans-RA, suggesting the absence of a negative feedback regulatory loop. Expression of the Raldh2 gene is known to be regulated by RA itself, suggesting that the main regulation of the hRALDH2 activity level is transcriptional. PMID: 27001866
  4. Study shows no evidence that genetic variants alter prostate cancer incidence, but show that SNPs in the ALDH1A2 gene affect prostate cancer mortality. PMID: 27643404
  5. a critical role of ALDH1A2-RAR signaling in the pathogenesis of head and neck cancer. PMID: 26634247
  6. High expression of ALDH1A2 and ALDH1B1 mRNA was found to be significantly correlated to worser survival in all NSCLC patients. PMID: 26366059
  7. the distribution of RALDH1, RALDH2, and RALDH3 in the postnatal eye was determined. PMID: 25793304
  8. ALDH1A2 is involved in the regulation of cancer stem cell properties in neuroblastoma. PMID: 25524880
  9. At the transcript level, the cisplatin + DEAB-resistant cells showed upregulated mRNA expression levels for ALDH1A2, ALDH1A3 isozymes and CD44 indicating the involvement of these markers in conferring chemoresistance PMID: 24884875
  10. DNA methylation at multiple CpG sites is associated with loss of control over alcohol drinking. PMID: 24236815
  11. Severe osteoarthritis of the hand associates with common variants within the ALDH1A2 gene and with rare variants at 1p31. PMID: 24728293
  12. These findings suggest that ALDH1A2 is the enzyme involved in retinoic acid biosynthesis in human germ cells. PMID: 24524833
  13. all three proteins (RDH10, RALDH2, and CRABP2) appeared to be required for ATRA production induced by activation of PPARgamma PMID: 23833249
  14. ALDH1A2 protein was effective in AraC resistance. ALDH1A2 knock-down induced sensitivity to AraC treatment in K562AC cells. ALDH1A2 overexpressed K562S cells acquired the AraC resistance. Ara-C-resistant patients had increased ALDH1A2. PMID: 23507523
  15. In vivo reduction of vitamin A levels results in an increase in astrocyte RALDH2 expression in the hippocampus. PMID: 22930583
  16. Aberrant methylation of ALDH1a2 gene is the main cause for gene transcriptional inactivation in human bladder cancer cell lines. 5-Aza-2'-deoxycitydine or trichostatin A treatment induces ALDH1a2 expression. PMID: 20450613
  17. A human ALDH1A2 gene variant is associated with increased newborn kidney size and serum retinoic acid. PMID: 20375987
  18. Individual variation in ALDH1A2/CRABP2 genes may account for subtle variations in retinoic acid-dependent human embryogenesis. PMID: 20308937
  19. The results of this study suggested a positive association between ALDH1A2 and schizophrenics in the Chinese population and support the retinoid hypothesis of schizophrenia. PMID: 19703508
  20. polymorphisms in ALDH1A2 may influence the risk for lumbosacral myelomeningocele PMID: 16237707
  21. Raldh2-/- knockout embryos exhibit defective morphogenesis of various forebrain derivatives, including the ventral diencephalon, the optic and telencephalic vesicles. PMID: 16368932
  22. Gene duplication event that gave rise to Aldh1a1 and Aldh1a2 was more recent than the duplication event that gave rise to Aldh1a3. PMID: 19478994
  23. our screen indicates that ALDH1A2 genetic variation is present in tetralogy of Fallot patients, suggesting a possible causal role for this gene in rare cases of human congenital heart disease PMID: 19886994

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Aldehyde dehydrogenase family
Database Links

HGNC: 15472

OMIM: 603687

KEGG: hsa:8854

STRING: 9606.ENSP00000249750

UniGene: Hs.643455

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*