Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
GPRC5A; GPCR5A; RAI3; RAIG1; Retinoic acid-induced protein 3; G-protein coupled receptor family C group 5 member A; Phorbol ester induced gene 1; PEIG-1; Retinoic acid-induced gene 1 protein; RAIG-1
Species
Homo sapiens (Human)
Expression Region
269-357aa
Target Protein Sequence
TKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDYEVKKEGS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 269-357 form the expressed segment for recombinant Human GPRC5A. The theoretical molecular weight of the GPRC5A protein is 37.0 kDa. This GPRC5A protein is produced using e.coli expression system. The GPRC5A gene fragment has been modified by fusing the N-terminal GST tag, providing convenience in detecting and purifying the recombinant GPRC5A protein during the following stages.
Retinoic acid-induced protein 3 (RAI3), also known as GPRC5A, belongs to the G protein-coupled receptor (GPCR) family. GPRC5A is expressed in several tissues, including the lung, and has been implicated in processes such as cell proliferation, differentiation, and apoptosis. GPRC5A's role in cancer biology, particularly in lung cancer, is of significant interest, as it may function as a tumor suppressor or promoter depending on the context.