Purity
Greater than 90% as determined by SDS-PAGE.
Species
Homo sapiens (Human)
Expression Region
25-256aa
Target Protein Sequence
DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 25-256 form the expressed segment for recombinant Human RNASET2. The expected molecular weight for the RNASET2 protein is calculated to be 56.1 kDa. This RNASET2 protein is produced using mammalian cell expression system. The RNASET2 gene fragment has been modified by fusing the C-terminal hFc tag, providing convenience in detecting and purifying the recombinant RNASET2 protein during the following stages.
Human ribonuclease T2 (RNASET2) is an endoribonuclease involved in RNA degradation and processing. It belongs to the RNase T2 enzyme family, characterized by its ability to cleave single-stranded RNA. RNASET2 mainly functions to cleave RNA substrates, promoting the turnover of RNA molecules and participating in the regulation of cellular RNA homeostasis. Beyond its canonical role in RNA degradation, RNASET2 has been implicated in diverse biological processes, including apoptosis, angiogenesis, and immune response modulation. Dysregulation of RNASET2 expression is associated with certain diseases, emphasizing its significance in cellular homeostasis and potential implications in therapeutic strategies. Ongoing research continues to unravel the multifaceted roles of RNASET2 in cellular physiology and pathology.
