Recombinant Human Ribonuclease T2 (RNASET2)

Code CSB-YP019810HU
Abbreviation Recombinant Human RNASET2 protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RNASET2
Uniprot No.
Research Area
Cancer
Alternative Names
Ribonuclease 6
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
25-256aa
Target Protein Sequence
DKRLRDNHEWKKLIMVQHWPETVCEKIQNDCRDPPDYWTIHGLWPDKSEGCNRSWPFNLEEIKDLLPEMRAYWPDVIHSFPNRSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGIKPSINYYQVADFKDALARVYGVIPKIQCLPPSQDEEVQTIGQIELCLTKQDQQLQNCTEPGEQPSPKQEVWLANGAAESRGLRVCEDGPVFYPPPKKTKH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
25-35 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ribonuclease that plays an essential role in innate immune response by recognizing and degrading RNAs from microbial pathogens that are subsequently sensed by TLR8. Cleaves preferentially single-stranded RNA molecules between purine and uridine residues, which critically contributes to the supply of catabolic uridine and the generation of purine-2',3'-cyclophosphate-terminated oligoribonucleotides. In turn, RNase T2 degradation products promote the RNA-dependent activation of TLR8. Plays also a key role in degradation of mitochondrial RNA and processing of non-coding RNA imported from the cytosol into mitochondria. Participates as well in degradation of mitochondrion-associated cytosolic rRNAs.
Gene References into Functions
  1. High RNASET2 expression is associated with reduced sperm motility. PMID: 29581387
  2. Studied association of and RNASET2, GPR174, and PTPN22 gene polymorphisms and liver damage(LD) due to Graves' disease (GD) hyperthyroidism. Found GPR174 rs3827440, PTPN22 rs3789604, and RNASET2 rs9355610 were significantly associated with altered GD-derived LD risk. PMID: 28568286
  3. RNASET2 is the enzyme that degrades the RNAs PMID: 28730546
  4. RNASET2, an IBD susceptibility gene, is a component of TL1A-mediated pathways regulating cytokine production. PMID: 28400196
  5. inhibits melanocyte outgrowth through interacting with shootin1; this effect may be associated with vitiligo pathogenesis PMID: 26293343
  6. Biological features allow to put forward the hypothesis that the RNASET2 protein can act as a molecular barrier for limiting the damages and tissue remodeling events occurring during the earlier step of cell transformation. PMID: 25797262
  7. RNASET2 may contribute to the development of vitiligo by inhibiting TNF Receptor-Associated Factor 2 expression and lead directly to apoptosis of melanocytes PMID: 26067323
  8. describe a multi-step strategy that allows production of highly pure, catalytically competent recombinant RNASET2 in both wild-type and mutant forms PMID: 25663099
  9. RNASET2 has antitumorigenic and antiangiogenic activities; a truncated version of human RNASET2, starting at E50 (trT2-50) and devoid of ribonuclease activity, has actin binding and anticancer-related biological activities PMID: 25426551
  10. RNASET2 tag SNP but not CCR6 polymorphisms is associated with autoimmune thyroid diseases in the Chinese Han population PMID: 25928629
  11. Results show that downregulation of RNASET2 and GGNBP2 in drug-resistant ovarian cancer tissues/cells contributes to the regulation of drug resistance in ovarian cancer. PMID: 24842157
  12. RNASET2 contributes to vitiligo pathogenesis by inhibiting TRAF2 expression. PMID: 24457966
  13. Genotypes of single nucleotide polymorphisms (SNPs) in RNASET2 gene were determined. PMID: 24327149
  14. Ribonuclease T2, an ancient and phylogenetically conserved RNase, has a role in development of ovarian neoplasms PMID: 23630276
  15. Higher expression of RNASET2 in the semen of asthenozoospermia individuals may contribute to sperm motility impairment. PMID: 23258633
  16. RNASET2--an autoantigen in anaplastic large cell lymphoma identified by protein array analysis. PMID: 22732457
  17. The catalytic features of RNase T2 in presence of bivalent cations were analyzed and the structural consequences of known clinical mutations were investigated. PMID: 22735700
  18. a possible involvement of RNASET2 in P-body formation in mammalian cells. PMID: 22188480
  19. Tax represses expression of RNase T2. PMID: 21994792
  20. Molecular signature induced by RNASET2, a tumor antagonizing gene, in ovarian cancer cells. PMID: 21646684
  21. The expression of the human tumor suppressor protein RNASET2 was studied in baculovirus-insect cell and Pichia pastoris heterologous systems. PMID: 21446958
  22. Familial cystic leukoencephalopathy arising in RNASET2-deficient humans is a manifestation of an lysosomal storage disorders in which rRNA is the best candidate for the noxious storage material. PMID: 21199949
  23. RNaseT2 is a cell growth regulator and it does not induce senescence in SV40 immortalized cell lines. PMID: 19382914
  24. RNASET2 found to significantly decrease the metastatic potential of ovarian cancer cell line in vivo; tumor suppression by RNASET2 is suggested to not be mediated by its ribonuclease activity PMID: 15809705
  25. The results presented herein represent a further advancement toward the molecular understanding of the tumour suppressive properties of the human RNASET2 protein. PMID: 16620762
  26. Loss of RNASET2 is associated with melanoma PMID: 18543608
  27. Study shows that loss-of-function mutations in the gene encoding the RNASET2 glycoprotein lead to cystic leukoencephalopathy, an autosomal recessive disorder with an indistinguishable clinical and neuroradiological phenotype. PMID: 19525954

Show More

Hide All

Involvement in disease
Leukoencephalopathy, cystic, without megalencephaly (LCWM)
Subcellular Location
Secreted. Lysosome lumen. Endoplasmic reticulum lumen. Mitochondrion intermembrane space.
Protein Families
RNase T2 family
Tissue Specificity
Ubiquitous. Higher expression levels observed in the temporal lobe and fetal brain.
Database Links

HGNC: 21686

OMIM: 612944

KEGG: hsa:8635

STRING: 9606.ENSP00000422846

UniGene: Hs.529989

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*