Recombinant Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3), partial

In Stock
Code CSB-MP880134HU
Abbreviation Recombinant Human SHANK3 protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-99aa
Target Protein Sequence
MQLSRAAAAAAAAPAEPPEPLSPAPAPAPAPPGPLPRSAADGAPAGGKGGPGRRAESPGAPFPGASGPGPGPGAGMDGPGASAVVVRVGIPDLQQTKCL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
40.0 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major scaffold postsynaptic density protein which interacts with multiple proteins and complexes to orchestrate the dendritic spine and synapse formation, maturation and maintenance. Interconnects receptors of the postsynaptic membrane including NMDA-type and metabotropic glutamate receptors via complexes with GKAP/PSD-95 and HOMER, respectively, and the actin-based cytoskeleton. Plays a role in the structural and functional organization of the dendritic spine and synaptic junction through the interaction with Arp2/3 and WAVE1 complex as well as the promotion of the F-actin clusters. By way of this control of actin dynamics, participates in the regulation of developing neurons growth cone motility and the NMDA receptor-signaling. Also modulates GRIA1 exocytosis and GRM5/MGLUR5 expression and signaling to control the AMPA and metabotropic glutamate receptor-mediated synaptic transmission and plasticity. May be required at an early stage of synapse formation and be inhibited by IGF1 to promote synapse maturation.
Gene References into Functions
  1. SHANK3 haploinsufficiency due to point mutations alone is sufficient to cause a broad range of phenotypic features associated with Phelan-McDermid syndrome. PMID: 29719671
  2. Our report details a 10-year-old boy with a de novo heterozygous c.1231del, p.Arg411Val frameshift variant in SHANK3, a high-risk candidate autism gene. We report significant speech delay and seizures as an association with this phenotype. PMID: 29939863
  3. SHANK3 expression correlated with ZO-1 and PKCepsilon in colonic tissue of patients with Crohn's disease. The expression level of SHANK3 affects ZO-1 expression and the barrier function in intestinal epithelial cells. PMID: 28906292
  4. We report a family with four affected individuals including the 37 year-old mother, her 12 year-old male monozygotic twins and 8 year-old daughter harboring a novel SHANK3 interstitial microdeletion PMID: 28754298
  5. the present study did not provide evidences to support the fact that SHANK3 variants could influence the susceptibility to Autism spectrum disorder in the Northeastern Han Chinese population PMID: 29408620
  6. SHANK3 expression was increased in the neocortex of temporal lobe epilepsy patients and rats. PMID: 27592227
  7. Missense mutation in SHANK3 gene is associated with schizophrenia. PMID: 28371232
  8. This study does not provide evidence for a major role of SHANK3 in the pathogenesis of bipolar disorder. PMID: 27512916
  9. Partial knockdown of SHANK3 expression in human dorsal root ganglion neurons abrogates TRPV1 function. PMID: 27916453
  10. GWA study identified maternal genetic effects not previously identified in ASD at a locus in SHANK3. PMID: 27876814
  11. SHANK1 and SHANK3 act as integrin activation inhibitors by sequestering active Rap1 and R-Ras via the SPN domain and thus limiting their bioavailability at the plasma membrane. PMID: 28263956
  12. No specific EEG abnormality is present in epilepsy due to to SHANK3 loss-of-function mutations. PMID: 27554343
  13. Haploinsufficiency of SHANK3 is a predisposing factor in adults with catatonia. PMID: 27519580
  14. post-transcriptional regulation of SHANK3 expression by three microRNAs (miRNAs), miR-7, miR-34a, and miR-504, is reported. PMID: 26572867
  15. these data suggest that SHANK3 mutations predispose to autism, at least partially, by inducing an Ih channelopathy that may be amenable to pharmacological intervention. PMID: 26966193
  16. De novo SHANK3 mutation causes Rett syndrome-like phenotype in a female patient. PMID: 25931020
  17. miR-7 binds to 3-prime untranslated regions of SHANK3 mRNA and causes the alteration of neuronal morphology and function, potentially playing a crucial role in the pathophysiological process of schizophrenia PMID: 25882257
  18. a mutation in SHANK3 that underscores its relevance in Autism Spectrum Disorder. PMID: 25646853
  19. This study identified and confirmed SHANK3 protein changes within the postsynaptic density in schizophrenia PMID: 25048004
  20. because the deletions in our patients do not involve the SHANK3 gene, we posit the existence of a new contiguous gene syndrome proximal to the smallest terminal deletions in the 22q13 region. PMID: 24700646
  21. This study is the first to identify specific chromosome 22q13.2q13.32 genomic regions, in addition to the terminal 22q13.33 genomic region encompassing SHANK3, associated with key phenotypes in Phelan-McDermid syndrome. PMID: 24136618
  22. The ability to alter the epigenetic modification and expression of SHANK3 by environmental factors suggests that SHANK3 may be a valuable biomarker for dissecting the role of gene and environment interaction in the etiology of ASD. PMID: 24186872
  23. our results suggested that this commonly genetic variant in SHANK3 gene strikingly decreased the risk of ism spectrum disorder in China. PMID: 24398551
  24. This study demonistrated that the uncoupling of ProSAP2/Shank3 nuclear shuttling from synaptic activity may represent a molecular mechanism that contributes to the pathology of SCZ in patients with mutations in ProSAP2/Shank3. PMID: 24382453
  25. analysis of SHANK3 mutations associated wtih autism and their effect on ligand binding to the ankyrin repeat region PMID: 23897824
  26. findings indicate that SHANK3 overexpression causes a hyperkinetic neuropsychiatric disorder PMID: 24153177
  27. We show that Phelan-McDermid syndrome neurons have reduced SHANK3 expression and major defects in excitatory, but not inhibitory, synaptic transmission PMID: 24132240
  28. SHANK3 variants were detected in patients affected with any autism spectrum disorders subtypes. SNP rs76224556 may have a genotype-phenotype correlation in autism spectrum disorders. PMID: 22892527
  29. Copy number variation in the SHANK3 is associated with variation in fluid intelligence. PMID: 23300510
  30. n this article we review recent findings in regard to higher brain functions of SHANK3, epigenetic regulation of SHANK3 expression, and SHANK3-related autism spectrum disorder--REVIEW PMID: 22749736
  31. Mutation or deletion of SHANK3 has been associated with autism. PMID: 23225497
  32. This study demonistrated that rare variants within the re-sequenced structural domains of ANK3 exon 48 do not contribute to BPD-I. PMID: 22966748
  33. This study revealed that alterations in transsynaptic signaling caused by ProSAP2/Shank3 gain or loss of function were also exhibited by neurons expressing ProSAP2/Shank3 carrying the autism-associated mutations R87C, R375C, Q396R, or InsG. PMID: 23100419
  34. These findings suggest that 22q13 deletions may be a more frequent cause for Chinese ID patients than previously thought, and the SHANK3 gene is involved in the neurite development PMID: 22509352
  35. the data of this study provided new insights into the synaptic alterations caused by SHANK3 mutations in humans and provide a robust cellular readout for the development of knowledge-based therapies. PMID: 21606927
  36. SHANK3 microdeletion is an important genetic component for autism, which may explain 2% typical autism cases. PMID: 22093425
  37. The SHANK3 gene was analyzed in 128 autistic patients with manifestations similar to those seen in the 22q13.3 deletion syndrome. PMID: 21378602
  38. Deletion size in the SHANK3 gene and adjacent regions determine the severity of phenotypes in Phelan-McDermid syndrome (22q13 deletion syndrome). PMID: 21984749
  39. [review] The presumptive exon containing the variant in the neurodevelopmentally disabled autism case highlighted in this review is not likely to be present in most or all SHANK3 transcripts. PMID: 21062623
  40. A translocation between Xq21.33 and 22q13.33 causes an intragenic SHANK3 deletion in a woman with Phelan-McDermid syndrome and hypergonadotropic hypogonadism. PMID: 21271662
  41. De novo mutations in the gene encoding the synaptic scaffolding protein SHANK3 in patients ascertained for schizophrenia. PMID: 20385823
  42. Haploinsufficiency of the gene SHANK3, which codes for a structural protein of the postsynaptic density, may be a major causative factor in the neurological symptoms of 22q13 deletion syndrome. PMID: 12920066
  43. Common breakpoint within SHANK3 responsible for mental retardation and developmental delays. PMID: 16284256
  44. Mutation of a single copy of SHANK3 on chromosome 22q13 can result in language and/or social communication disorders. PMID: 17173049
  45. Haploinsufficiency of SHANK3 can cause a monogenic form of autism in sufficient frequency to warrant consideration in clinical diagnostic testing. PMID: 17999366
  46. Novel de novo SHANK3 mutation in autistic patients is reported. PMID: 18615476
  47. Shank3 is one of a number of host synaptic proteins likely to play key roles in bacteria-host interactions. PMID: 19371741
  48. SHANK3 deletions may be limited to lower functioning individuals with autism PMID: 19384346
  49. Chromosome 22q13.3 deletion syndrome with a de novo interstitial 22q13.3 cryptic deletion disrupting SHANK3 is reported. PMID: 19454329
  50. We suggest that SHANK3 might not represent a major susceptibility gene for autism in Chinese Han population PMID: 19566951

Show More

Hide All

Involvement in disease
Phelan-McDermid syndrome (PHMDS); Schizophrenia 15 (SCZD15)
Subcellular Location
Cytoplasm. Cell junction, synapse, postsynaptic density. Cell projection, dendritic spine.
Tissue Specificity
Expressed in the cerebral cortex and the cerebellum.
Database Links

HGNC: 14294

OMIM: 606230

KEGG: hsa:85358

STRING: 9606.ENSP00000442518

UniGene: Hs.149035

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*