Recombinant Human Serine/arginine-rich splicing factor 10 (SRSF10)

Code CSB-EP525638HU
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP525638HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SRSF10.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP525638HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SRSF10.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SRSF10
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
40 kDa SR repressor protein; 40 kDa SR-repressor protein; Anti TLS associated protein with SR repeats; arginine/serine-rich 13A; FUS interacting protein serine arginine rich 1; FUS interacting protein serine arginine rich 2; FUS interacting serine arginine rich protein 1; FUS-interacting serine-arginine-rich protein 1; FUSIP1; FUSIP2; NSSR; OTTHUMP00000015774; Serine arginine repressor protein 40 kDa; Serine/arginine-rich splicing factor 10; SFRS13; SFRS13A; Splicing factor; Splicing factor arginine serine rich 13; Splicing factor SRp38; SRp38; SRp40; SRrp40; SRS10_HUMAN; Srsf10; TASR; TASR1; TASR2; TLS associated protein TASR1; TLS associated protein TASR2; TLS associated protein with Ser Arg repeats; TLS associated protein with SR repeats; TLS associated serine arginine protein 1; TLS associated serine arginine protein 2; TLS associated serine arginine protein; TLS associated SR protein; TLS-associated protein with Ser-Arg repeats; TLS-associated protein with SR repeats; TLS-associated serine-arginine protein; TLS-associated SR protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-183aa
Target Protein Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
38.2kDa
Protein Length
Full Length of Isoform 3
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing. Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
Gene References into Functions
  1. DNA damage co-opts SRSF10 to control splicing decisions in transcripts encoding components involved in DNA repair, cell-cycle control, and apoptosis. PMID: 27851963
  2. Results show that YTHDC1 promotes exon inclusion in targeted mRNAs through recruiting pre-mRNA splicing factor SRSF3 while blocking SRSF10 mRNA binding. PMID: 26876937
  3. SRSF10 is a key regulator of BCLAF1 pre-mRNA splicing and the maintenance of oncogenic features in human colon cancer cells PMID: 25091051
  4. In colorectal cancer, NSSR1 was highly expressed in the nucleus of tumor cells. PMID: 21984158
  5. Splicing thermotolerance is acquired through maintenance of SRSF10 phosphorylation and that this is mediated at least in part by Hsp27. PMID: 21135127
  6. Data show that SFRS13A expression was significantly associated with LDLR splicing efficiency in vivo. PMID: 20232416
  7. found to be dephosphorylated specifically in mitotic cells; show that dephosphorylated SRp38 is required for the observed splicing repression PMID: 12419250
  8. SRp38 plays a crucial role in cell survival under stress conditions by inhibiting the splicing machinery PMID: 14765198
  9. SRp38 contains two arginine- and serine-rich domains (RS), one of which has a unique, second-step repression activity, while both function together as a splicing repression domain. PMID: 16135820

Show More

Hide All

Subcellular Location
Nucleus speckle. Cytoplasm.
Protein Families
Splicing factor SR family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 16713

OMIM: 605221

KEGG: hsa:10772

STRING: 9606.ENSP00000420195

UniGene: Hs.3530

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
webinars: DT3C facilitates antibody internalization X
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*