Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

LATS1

Uniprot No.

O95835

Research Area

Cancer

Alternative Names

(Large tumor suppressor homolog 1)(WARTS protein kinase)(h-warts)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

705-1090aa

Target Protein Sequence

FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The production of recombinant Human LATS1 protein involves manipulating the expression of the desired gene in e.coli cells. The sequence (705-1090aa) of foreign DNA is merged with an expression vector and subsequently introduced into e.coli cells. Positive cells are chosen and cultivated to induce the expression of the desired protein. A N-terminal 10xHis tag and C-terminal Myc tag is fused to the protein. The resulting recombinant Human LATS1 protein undergoes purification through affinity purification, with a purity exceeding 85%, as confirmed by SDS-PAGE.

Target Background

Function

Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. Acts as a tumor suppressor which plays a critical role in maintenance of ploidy through its actions in both mitotic progression and the G1 tetraploidy checkpoint. Negatively regulates G2/M transition by down-regulating CDK1 kinase activity. Involved in the control of p53 expression. Affects cytokinesis by regulating actin polymerization through negative modulation of LIMK1. May also play a role in endocrine function. Plays a role in mammary gland epithelial cell differentiation, both through the Hippo signaling pathway and the intracellular estrogen receptor signaling pathway by promoting the degradation of ESR1.

Gene References into Functions

disruption of TAZ/YAP activity alleviates tumor burden in Lats1/2-deficient mice and inhibits human malignant peripheral nerve sheath tumors cell proliferation PMID: 29438698
Knockdown of Lats1/2 prevented the cytoplasmic delocalization of Yap1/Taz proteins in response to AICAR. PMID: 29730476
Results provide evidence that LATS1 undergoes intronic premature polyadenylation (pPA) following large internal exons, and that N(6)-methyladenosine levels in this exon are reduced in pPA-activated breast cancer cells. PMID: 29362392
TNFAIP8 regulates Hippo pathway through interacting with LATS1 to promote cell proliferation. PMID: 28926138
The TAZ WW domain exhibits a binding preference for the second of the two PPxY motifs of LATS1 in vitro. We modelled the structure of the domain in complex with LATS1 PPxY2 peptide and, through molecular dynamics simulations, show that WW domain-PPxY2 complex is stable with some flexibility in the peptide region. PMID: 29787761
These results suggest that LMO3 promotes hepatocellular carcinoma (HCC) cell invasion and anoikis inhibition by interacting with LATS1 and suppressing Hippo signaling. LMO3 may serve as a potential therapeutic target for HCC in future. PMID: 30219064
FOXP4-AS1 is overexpressed in osteosarcoma (OS), and is the independent risk factor in OS prognosis. Upregulated FOXP4-AS1 promotes the proliferation, migration and cell cycle, but inhibits apoptosis of OS cells. Furthermore, FOXP4-AS1 participates in the development and progression of OS by downregulating LATS1 via binding to LSD1 and EZH2. PMID: 29859193
Results confirmed that S100A1 interacted with LATS1. LATS1 depletion significantly reduced the effects of S100A1 on cell growth rate and apoptosis, and there was a positive correlation between phosphorylated LATS1 and S100A1 in hepatocellular carcinoma (HCC) clinical samples, indicating that LATS1 was responsible for the S100A1-induced changes in cancer cell growth and Hippo signaling. PMID: 29901195
Knockdown of LATS1 attenuated the suppression of FUS overexpression on hepatocellular carcinoma progression, and LATS1 expression was positively correlated with FUS expression in hepatocellular carcinoma tissues. PMID: 30308519
YAP1 and LATS1 can be considered as new prognostic factors in clear cell renal cell carcinoma. PMID: 29850494
lncARSR interacts with Yes-associated protein (YAP) to block its phosphorylation by LATS1, facilitating YAP nuclear translocation. PMID: 27886176
LATS1 is an independent prognostic factor and may play an important role in non-Small Cell Lung Cancer progression and may serve as a novel therapeutic target of non-Small Cell Lung Cancer. PMID: 28434174
Increased miR-424 expression or decreased LATS1 expression was associated with pathological stage and unfavorable prognosis of GC patients. PMID: 28893265
Deregulation of LATS1 and YAP1 expression is associated with clear cell renal cell carcinoma progression and poor patient survival. PMID: 28504812
In the present study, we investigated the expression of activated core Hippo pathway kinases (pMST1/2 and pLATS1/2) in a series of 57 HER2-positve and triple-negative breast cancer patients who received neoadjuvant therapy . PMID: 28387539
LATS1/2 signaling via the Hippo pathway regulates human megakaryocytic differentiation. PMID: 27786336
Our findings suggest that LATS1 is a potential candidate tumor suppressor and inhibits the growth and metastasis of gastric carcinoma cells via downregulation of the YAP signaling. PMID: 26921249
Low LATS1 expression is associated with breast cancer. PMID: 28754671
Loss of LATS1 expression is associated with pancreatic cancer. PMID: 28720576
TNFAIP8 regulates Hippo (MST1/2) signaling through its interaction with LATS1. PMID: 28152516
Lats1 SUMOylation at K751 suppresses its kinase activity and subsequently attenuates its tumor-suppressor functions in HepG2 cells. PMID: 27847303
High LATS1 expression is associated with Colorectal Tumorigenesis and Metastasis. PMID: 27325643
A group of miRNAs have been demonstrated to directly target components of the Hippo signaling pathway, such as YAP, TAZ and LATS1/2 in oncogenesis. (Review) PMID: 27973704
findings reveal a non-canonical (that is, YAP/TAZ-independent) effect of LATS in the regulation of human breast cell fate PMID: 28068668
AGO2 immunoprecipitation revealed LATS1 as a novel proapoptotic target of miR-21 in T cells. PMID: 28075055
LATS1 was downregulated in cervical cancer and may suppress cell growth and invasion through regulating the expression of cyclin E, p27, MMP9 and YAP. PMID: 28259899
PARD3 promotes interaction between PP1A and LATS1 to induce LATS1 dephosphorylation and inactivation,leading to dephosphorylation and activation of TAZ PMID: 26116754
Loss of LATS1 expression is associated with breast neoplasms. PMID: 25772246
Phosphorylation of CHO1 at S716 by Lats1 regulate its centrosomal localization, and that phosphorylated CHO1 interacts with and activates LIMK1 during early mitosis. PMID: 25786116
LATS1 phosphorylates the Thr7 residue of the APC/C component CDC26 directly PMID: 25723520
These results demonstrated that as an inhibitor of YAP, LATS1 was decreased via downregulation of YAP using RNAi. This therefore indicated that the change in YAP levels in hepatocellular carcinoma cells may regulate LATS1 in a feedback manner. PMID: 25625370
LATS1 promoter hypermethylation is associated with oral squamous cell carcinomas. PMID: 25743838
results reported here further support that LATS1/2 act normally as tumor suppressors and loss of their functions contributes to human cancer development PMID: 25482410
Phosphorylation of S716 NDR/LATS, present only in the longest Kif23 isoform, is required for phosphorylation at S814, revealing phosphorylation at these two sites, and differential regulation of Kif23-14-3-3 interaction for the two Kif23 isoforms. PMID: 25658096
Findings suggest that polyomavirus middle T-antigen (PyMT) activates the Hippo pathway tumor suppressor Lats in a Src-dependent manner. PMID: 25362852
LATS1 and LATS2 kinases play an important role in the regulation of NS5A function through site-specific post-translational modification and that phosphorylation of Ser/Thr71 is essential for optimal viral genome replication. PMID: 25044019
ITCH up-regulation and LATS1 down-regulation were closely associated with tumorigenesis and progression of SCC PMID: 25618271
Both LATS1 and LATS2 were not related with the clinical variables in mucinous and clear cell carcinoma PMID: 25841306
The control of LATS activation by angiotensin II and subsequent YAP localization is important for podocyte homeostasis and survival. PMID: 25393475
both LATS1 demethylation and overexpression of LATS1 downregulated the expression of Yes-associated protein (YAP), inhibited cell proliferation, induced cell apoptosis and cell cycle G1 arrest in 786-O cells PMID: 25270913
ivation of MSH4 in germ cells may have played a role in the acquisition of additional TP53 and LATS1 germline mutations in a Li-Fraumeni family PMID: 25041856
overexpression of Kibra rescues the increased cell migration and aberrant three-dimensional morphogenesis induced by knockdown of PTPN14, and this rescue is mediated through the activation of the upstream LATS1 kinase PMID: 25023289
Data indicate that tumour suppressor RASSF1A triggers large tumor suppressor kinase 1 (LATS)-CDK2 interaction and restricts CDK2 kinase activity towards BRCA2. PMID: 25218637
These results indicate that LATS1 may play an important role in NSCLC, and may serve as a novel therapeutic target of non-small-cell lung cancer (NSCLC). PMID: 24682895
NF2 loss-driven derepressed CRL4(DCAF1) promotes activation of YAP by inhibiting hippo pathwat kinases Lats1 and 2 in the nucleus. PMID: 25026211
LATS1 and LATS2 mutations from cancers can lead to loss or reduction of their growth-inhibitory activity PMID: 24026096
In conclusion, N-terminally truncated Lats1 induced Lats2 downregulation and Yap protein accumulation, leading to chromosomal instability and tumorigenesis. PMID: 23230145
These results collectively suggest that the Hippo pathway negatively regulates the actin-binding activity of Amot family members through direct phosphorylation. PMID: 24225952
Thus AMOT is a direct substrate of Lats1/2 mediating functions of the Hippo pathway in endothelial cell migration and angiogenesis. PMID: 24106267
Decreased expression of LATS1 in CRC is associated with promoter hypermethylation, but not microsatellite instability status PMID: 23885148

Hide All

Subcellular Location

Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body.

Protein Families

Protein kinase superfamily, AGC Ser/Thr protein kinase family

Tissue Specificity

Expressed in all adult tissues examined except for lung and kidney.

Database Links

HGNC: 6514

OMIM: 603473

KEGG: hsa:9113

STRING: 9606.ENSP00000253339

UniGene: Hs.549084

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP012769HU
Abbreviation	Recombinant Human LATS1 protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Serine/threonine-protein kinase LATS1 (LATS1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage