Recombinant Human Serrate RNA effector molecule homolog (SRRT), partial

Code CSB-YP880129HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP880129HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP880129HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP880129HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP880129HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
SRRT
Uniprot No.
Alternative Names
ARS2 protein; Arsenate resistance protein ARS2; Arsenite resistance protein 2; Arsenite resistance protein; Arsenite-resistance protein 2; ASR2; MGC126427; Serrate; Serrate RNA effector molecule; Serrate RNA effector molecule homolog (Arabidopsis); Serrate RNA effector molecule homolog; SRRT; SRRT_HUMAN
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are currently in the process of adding the following products from you to our catalogue:
CSB-YP880129HU
CSB-EP880129HU
CSB-BP880129HU
CSB-MP880129HU
Please may I ask for the AA numbers for the recombinant fragment and the expected MW for these? Could I also please confirm what the tag is for these proteins?

A:
Thanks for your inquiry. Here is the detailed information as you requested.
Recombinant Human Serrate RNA effector molecule homolog(SRRT),partial
CSB-YP880129HU >> Yeast Expected tag is N-terminal 6xHis-tagged. MW of target protein is 50KD, MW of tag protein is 2KD. MW of the fusion protein is 52KD.
CSB-EP880129HU >> E.coli Expected tag is N-terminal 6xHis-tagged. MW of target protein is 50KD, MW of tag protein is 5KD. MW of the fusion protein is 55KD.
CSB-BP880129HU >> Baculovirus Expected tag is N-terminal 6xHis-tagged. MW of target protein is 50KD, MW of tag protein is 4KD. MW of the fusion protein is 54KD.
CSB-MP880129HU >> Mammalian cell Expected tag is N-terminal 6xHis-tagged. MW of target protein is 50KD, MW of tag protein is 5.5KD or 6.5KD(For different vector). MW of the fusion protein is 55.5KD or 56.5KD.
Expression region: 2-429aa; Partial protein;
Sequence:

GDSDDEYDRRRRDKFRRERSDYDRSRERDERRRGDDWNDREWDRGRERRSRGEYRDYDRNRRERFSPPRHELSPPQKRMRRDWDEHSSDPYHSGYEMPYAGGGGGPTYGPPQPWGHPDVHIMQHHVLPIQARLGSIAEIDLGVPPPVMKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDEVGKRRQEARGALQNRLRVFLSLMETGWFDNLLLDIDKADAIVKMLDAAVIKMEGGTENDLRILEQEEEEEQAGKPGEPSKKEEGRAGAGLGDGERKTNDKDEKKEDGKQAENDSSNDDKTKKSEGDGDKEEKKEDSEKEAKKSSKKRNRKHSGDDSFDEGSVSESESESESGQAEEEKEEAEEALKEKEKPKEEEWEKPKDAAGLECKPRPLHKTCSLFMRNIA

Target Background

Function
Acts as a mediator between the cap-binding complex (CBC) and the primary microRNAs (miRNAs) processing machinery during cell proliferation. Contributes to the stability and delivery of capped primary miRNA transcripts to the primary miRNA processing complex containing DGCR8 and DROSHA, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs. Binds capped RNAs (m7GpppG-capped RNA); however interaction is probably mediated via its interaction with NCBP1/CBP80 component of the CBC complex. Involved in cell cycle progression at S phase. Does not directly confer arsenite resistance but rather modulates arsenic sensitivity. Independently of its activity on miRNAs, necessary and sufficient to promote neural stem cell self-renewal. Does so by directly binding SOX2 promoter and positively regulating its transcription.
Gene References into Functions
  1. Study present the human ARS2 crystal structure, which exhibits similarities and metazoan-specific differences to the plant homologue SERRATE, most notably an additional RRM domain. RRM domain is required to bind RNA, whereas a basic patch in the C-terminal leg of ARS2 mediates the interaction with FLASH. PMID: 29703953
  2. define two mutually exclusive complexes CBC-NELF-E and CBC-ARS2-PHAX, which likely act in respectively earlier and later phases of transcription PMID: 29101316
  3. ARS2 depletion negatively impacts levels of promoter-proximal RNA polymerase II at protein-coding genes. It is involved in transcription termination events within first introns of pc genes. ARS2 plays a role in transcription termination-coupled RNA turnover at short transcription units like snRNA-, replication-dependent histone-, promoter upstream transcript- and enhancer RNA-loci. PMID: 28973446
  4. 2,3,5,6-Tetramethylpyrazine (TMP) down-regulated arsenic-induced heme oxygenase-1 and ARS2 expression by inhibiting Nrf2, NF-kappaB, AP-1 and MAPK pathways in human proximal tubular cells. PMID: 26404762
  5. Ars2 is overexpressed in HCC and may have prognostic value; it might play an important role in HCC proliferation and miR-21 expression. PMID: 24272391
  6. Ars2 contributes to histone mRNA 3' end formation and expression and these functional properties of Ars2 are negatively regulated by interaction with 7SK RNA. PMID: 22244333
  7. These data indicate ARS2 is essential for early mammalian development and is likely involved in an essential cellular process. PMID: 18086880
  8. These findings provide evidence for a role for Ars2 in RNA interference regulation during cell proliferation. PMID: 19632182
  9. Validated occurrence of an unusual TG 3' splice site in intron 17 (NM_015908). PMID: 17672918
  10. Nomenclature. Original paper and GenBank submission by Rossman and Wang (1999) called the gene Asr2 (arsenite resistance protein 2) as opposed to Ars2 (arsenate resistance protein 2). PMID: 10069470

Show More

Hide All

Subcellular Location
Nucleus, nucleoplasm. Cytoplasm.
Protein Families
ARS2 family
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 24101

OMIM: 614469

KEGG: hsa:51593

STRING: 9606.ENSP00000314491

UniGene: Hs.111801

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1