Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

SAA2

Uniprot No.

P0DJI9

Research Area

Cancer

Alternative Names

SAA2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

19-122aa

Target Protein Sequence

RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISNARENIQRLTGRGAEDSLADQAANKWGRSGRDPNHFRPAGLPEKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Major acute phase reactant.

Gene References into Functions

The prevalence of the SAA2 polymorphisms (rs 2445174 and rs2468844) did not differ significantly between the groups of ankylosing spondylitis patients with and without amyloidosis. PMID: 26300108
successful quantification of SAA2 in crude serum by MRM, for the first time, shows that SAA2 can be a good biomarker for the detection of lung cancers. PMID: 22300576
The glucocorticoid response element of the SAA2 promoter is dysfunctional compared to that of SAA1, hence glucocorticoids are unable to enhance the cytokine-driven transcriptional activity of SAA2. PMID: 12077270
saa2 is regulated by tumor necrosis factor-alpha, interleukin-6, and glucocorticoids in hepatic and epithelial cells. PMID: 14871291
Increased expression of SAA2 by adipocytes in obesity may play a critical role in local and systemic inflammation and free fatty acid production and could be a direct link between obesity and its comorbidities. PMID: 16737350
CRP and SAA strongly correlated up to the fifth day of observation but were not good predictors of mortality in septic shock. PMID: 18385816

Hide All

Involvement in disease

Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA2 protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

Subcellular Location

Secreted.

Protein Families

SAA family

Tissue Specificity

Expressed by the liver; secreted in plasma.

Database Links

HGNC: 10514

OMIM: 104751

KEGG: hsa:6289

STRING: 9606.ENSP00000256733

UniGene: Hs.731376

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP020657HU
Abbreviation	Recombinant Human SAA2 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Serum amyloid A-2 protein (SAA2)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage