Recombinant Human Sodium-dependent phosphate transport protein 2B(SLC34A2),partial

Code CSB-YP021581HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. O95436
Relevance May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border mbrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B ;Na(+)/Pi cotransporter 2B ;NaPi-2bSolute carrier family 34 member 2
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Research Area Signal Transduction
Source Yeast
Gene Names SLC34A2
Protein Names Recommended name: Sodium-dependent phosphate transport protein 2B Short name= Sodium-phosphate transport protein 2BAlternative name(s): Na(+)-dependent phosphate cotransporter 2B NaPi3b Sodium/phosphate cotransporter 2B Short name=
Expression Region 574-689aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 15.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Involvement in disease Pulmonary alveolar microlithiasis (PALM)
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families SLC34A transporter family
Tissue Specificity Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.
Database Links

HGNC: 11020

OMIM: 265100

KEGG: hsa:10568

STRING: 9606.ENSP00000371483

UniGene: Hs.479372

Related Products

SLC34A2 Antibodies

SLC34A2 Antibodies for Homo sapiens (Human)

SLC34A2 Proteins

SLC34A2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.