Product Details

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/mL can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC50 is 32.86-37.66 ng/mL.

Target Names

SLC34A2

Uniprot No.

O95436

Alternative Names

Sodium-phosphate transport protein 2B;Na+;NaPi3b;Sodium/phosphate cotransporter 2B;Na+;NaPi-2b;Solute carrier family 34 member 2

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

234-362aa

Target Protein Sequence

VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL

Mol. Weight

45.5kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal mFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Sodium-dependent phosphate transport protein 2B regulates inorganic phosphate homeostasis in epithelial tissues, and its dysregulation has been implicated in pulmonary alveolar microlithiasis and certain cancers. This recombinant fragment spanning residues 234–362 demonstrates robust antibody-binding activity in functional ELISA, with an EC50 of 32.86–37.66 ng/mL when immobilized at 2 μg/mL, confirming that the expressed extracellular domain retains native conformational epitopes. The validated binding capacity supports its use in antibody development workflows, including epitope mapping and as an ELISA standard for anti-SLC34A2 reagent characterization. Produced in mammalian cells with dual His and mFc tags, the protein achieves greater than 90% purity by SDS-PAGE and maintains endotoxin levels below 1.0 EU/μg, satisfying the quality thresholds commonly required for ligand-binding assays and structural studies of transporter extracellular domains.

Target Background

Function

May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

Gene References into Functions

The upstream breakpoint lies in the same region as the breakpoint of a fused gene SLC34A2-ROS1, which encodes a constitutive kinase in the lung cancer cell line HCC78 and nonsmall-cell lung cancer (NSCLC), suggesting that the deletion in this family is a hot spot for recombination, not only in cancer samples with somatic mutation, but also in PAM patients with germline genetic defects of SLC34A2. PMID: 30262706
SLC34A2 plays a crucial promoting role in colorectal cancer development. PMID: 29653487
Studied expression of solute carrier family 34 member 2 (SLC34A2/NaPi2b) in epithelial ovarian cancer using monoclonal antibody MX35 and immunohistochemistry. Different staining intensities were observed in different grades of epithelial ovarian cancer. PMID: 28464843
Low SLC34A2 expression is associated with non-small cell lung cancer. PMID: 26910912
SLC34A2 has an important role in promoting proliferation and tumorigenicity of BC. PMID: 28151475
SLC34A2 was down-regulated in osteosarcoma patients.SLC34A2 interacted with PTEN, and decreased the phosphorylation of PI3K and AKT, which inactivated the PI3K/AKT signaling pathway. PMID: 28777670
High expression of SLC34A2 was identified in about 2/3 patients and correlated with significantly better patient's overall survival. Epidermal growth factor receptor mutations were detected in about 53% of patients with no statistically significant difference to patient's overall survival. Anaplastic lymphoma kinase rearrangement was found in 8 out of 175 patients, harboring this abnormality leads to shorter overall survi PMID: 28720066
we elucidated that miR-939 exerted its function mainly through inhibiting SLC34A2/Raf/MEK/ERK pathway, which is activated in GC. Multivariate analysis identified miR-939, SLC34A2, and their combination as independent indicators for poor prognosis and tumor recurrence in GC patients. PMID: 28114937
a novel role of SLC34A2 inbreast cancer stem cells (BCSCs) state regulation and establishes a rationale for targeting the SLC34A2/PI3K/AKT/SOX2 signaling pathway for breast cancer therapy. PMID: 28381172
Knockdown of SLC34A2 inhibits proliferation. PMID: 28281971
Our work sheds new light on the nature of the state of lung cancer stem cell-like cells and the role of SLC34A2 in the tumorigenicity of these cells PMID: 26846105
our data indicated that SLC34A2 could exert significantly suppressive effects on tumorigenesis and progression of NSCLC. SLC34A2 might provide new insights for further understanding the early pathogenesis of human non-small cell lung cancer PMID: 26156586
SLC34A2 might be associated with the initiation and progression of lung adenocarcinoma PMID: 25017204
Data indicate that humanized monoclonal antibody Rebmab200 and murine monoclonal antibody MX35 monoclonal antibodies had similar specificity for sodium phosphate transporter NaPi2b. PMID: 23936189
investigation revealed that the c.910A > T mutation in the SCL34A2 gene was responsible for pulmonary alveolar microlithiasis (PAM) patients in China PMID: 23164546
identified 2 cases of pulmonary alveolar microlithiasis(PAM) with new mutations of SLC34A2 gene; identified the NaPi-IIb in a aortic valve; hypothesize that mutations in SLC34A2 may play a role in development of aortic valve calcification and arteriosclerosis PMID: 22336687
a comprehensive analysis indicates that SCL34A2 is the only gene of the several phosphate transporters genes whose expression differentiates normal from carcinoma samples, suggesting it might exert a major role in ovarian carcinomas. PMID: 22553815
The performed study revealed that SLC34A2 gene exhibited the most distinct change in expression and may become a molecular marker of papillary thyroid cancer PMID: 17091453
study provides the data on the pattern of NaPi2b expression and cellular localization in breast, lung and ovarian cancers PMID: 21956469
Upregulation of SLC34A2 gene expression in well-differentiated tumors may reflect cell differentiation processes during ovarian cancerogenesis and could serve as potential marker for ovarian cancer diagnosis and prognosis. PMID: 21716206
There was a significantly increased gene expression of SLC34A2 (normal tissues: 6.71+/-0.77; tumour tissues: 10.29+/-0.80) among breast cancer tissues compared with normal tissues. PMID: 21036732
In human lung alveolar epithelial cells, the content of calcium and phosphate in cell supernatant decreased with increased amount of SLC34A2 mRNA. PMID: 19134407
study describes mutations in SLC34A 2 gene in an inbred Turkish family with three siblings diagnosed with pulmonary alveolar microlithiasis(PAM); findings suggest that impaired activity of the SLC34A2 gene may be responsible for familial PAM PMID: 20046000
A novel mutation in exon 8 of the SLC34A2 gene were associated with pulmonary alveolar microlithiasis in Chinese pedigree. PMID: 20017296
The current study was performed to characterize the minimal promoter region and transcriptional factor(s) necessary to activate gene expression of NaPi-IIb in human intestinal cells. PMID: 15458926
Study identified a pulmonary alveolar microlithiasis locus by homozygosity mapping to 4p15, then identified, by a candidate-gene approach, the gene responsible for the disease as SLC34A2, which is involved in phosphate homeostasis in several organs. PMID: 16960801
Mutations in the SLC34A2 gene that abolish normal gene function cause pulmonary alveolar microlithiasis. PMID: 17095743
The monoclonal antibodies were shown to recognize specifically transiently overexpressed and endogenous NaPi2b in commonly used immunoassays. PMID: 18724815
SLC34A2 is associated with sodium-lithium countertransport activity and blood pressure PMID: 19119262
The gene responsible for PAM, SLC34A2, has been identified. It encodes a type IIb sodium-dependent phosphate transporter, the function of which provides an insight into the pathogenesis of this disease. PMID: 19617834

Hide All

Involvement in disease

Pulmonary alveolar microlithiasis (PALM)

Subcellular Location

Membrane; Multi-pass membrane protein.

Protein Families

SLC34A transporter family

Tissue Specificity

Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.

Database Links

HGNC: 11020

OMIM: 265100

KEGG: hsa:10568

STRING: 9606.ENSP00000371483

UniGene: Hs.479372

Code	CSB-MP021581HU1
Abbreviation	Recombinant Human SLC34A2 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/ml can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC₅₀ is 32.86-37.66 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage