Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

In Stock
Code CSB-MP021581HU1
Abbreviation Recombinant Human SLC34A2 protein, partial (Active)
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/ml can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC50 is 32.86-37.66 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 μg/mL can bind Anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU). The EC50 is 32.86-37.66 ng/mL.
Target Names
Uniprot No.
Alternative Names
Sodium-phosphate transport protein 2B;Na+;NaPi3b;Sodium/phosphate cotransporter 2B;Na+;NaPi-2b;Solute carrier family 34 member 2
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
234-362aa
Target Protein Sequence
VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL
Mol. Weight
45.5kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human SLC34A2 protein is expressed in mammalian cells, which allows for proper post-translational modifications critical for its function. The recombinant SLC34A2 protein corresponds to the amino acid sequence from 234 to 362 of the human SLC34A2 protein, which is essential for its transport activity. It is tagged with a 10xHis tag at the N-terminus and an mFc tag at the C-terminus, facilitating purification and detection. Its endotoxin level is less than 1.0 EU/μg, as determined by the LAL method, ensuring low toxicity for experimental applications. The SLC34A2 protein's functionality is assessed in a functional ELISA. At a concentration of 2 μg/mL, immobilized SLC34A2 can effectively bind to the anti-SLC34A2 recombinant antibody (CSB-RA021581MA2HU), with an EC50 value ranging from 32.86 to 37.66 ng/mL, indicating its potency in binding interactions.

The human SLC34A2 protein plays a vital role in phosphate transport within the body. SLC34A2 primarily functions as a sodium-dependent phosphate transporter that facilitates the transcellular absorption of inorganic phosphate. This phosphate transport is crucial for several physiological processes, including phosphate homeostasis and cellular differentiation, particularly within the type II alveolar epithelial cells in the lungs [1][2][3].

SLC34A2 synthesizes surfactant in alveolar type II cells and is essential for reducing surface tension and preventing alveolar collapse [4][5]. Dysregulation or mutations in this SLC34A2 gene can lead to pulmonary alveolar microlithiasis, a rare lung disease characterized by the accumulation of calcium phosphate [6][7]. Additionally, SLC34A2 expression is linked to cancer pathology. For instance, higher levels of SLC34A2 have been associated with improved prognosis in non-small cell lung cancer (NSCLC) patients [8][9][10]. SLC34A2 has been implicated in various malignancies, including ovarian and thyroid cancers, potentially serving as a therapeutic target in antibody-drug conjugate (ADC) treatments aimed at tumors expressing this protein [9][10].

References:
[1] X. Zhang, X. Ke, et al. Microrna-410 acts as oncogene in nsclc through downregulating slc34a2 via activating wnt/β-catenin pathway. Oncotarget, vol. 7, no. 12, p. 14569-14585, 2016. https://doi.org/10.18632/oncotarget.7538
[2] D. Wu, S. Hu, Y. Hou, Y. He, & S. Liu. Identification of potential novel biomarkers to differentiate malignant thyroid nodules with cytological indeterminate. BMC Cancer, vol. 20, no. 1, 2020. https://doi.org/10.1186/s12885-020-6676-z
[3] N. Kurabe, T. Hayasaka, et al. Visualization of phosphatidylcholine (16:0/16:0) in type ii alveolar epithelial cells in the human lung using imaging mass spectrometry. Pathology International, vol. 63, no. 4, p. 195-200, 2013. https://doi.org/10.1111/pin.12050
[4] Y. Li, X. Chen, & H. Lu. Knockdown of slc34a2 inhibits hepatocellular carcinoma cell proliferation and invasion. Oncology Research Featuring Preclinical and Clinical Cancer Therapeutics, vol. 24, no. 6, p. 511-519, 2016. https://doi.org/10.3727/096504016x14719078133483
[5] Z. Liu, X. Zhao, et al. Heterogeneous pattern of gene expression driven by ttn mutation is involved in the construction of a prognosis model of lung squamous cell carcinoma. Frontiers in Oncology, vol. 13, 2023. https://doi.org/10.3389/fonc.2023.916568
[6] H. Al-Maghrabi, G. Mokhtar, J. Al‐Maghrabi, & A. Meliti. Pulmonary alveolar microlithiasis: a report of two unique cases. Respiratory Medicine Case Reports, vol. 29, p. 100980, 2020. https://doi.org/10.1016/j.rmcr.2019.100980
[7] H. Olauson, V. Brandenburg, & T. Larsson. Mutation analysis and serum fgf23 level in a patient with pulmonary alveolar microlithiasis. Endocrine, vol. 37, no. 2, p. 244-248, 2010. https://doi.org/10.1007/s12020-009-9299-3
[8] L. Cao, Z. Cao, et al. Detection of potential mutated genes associated with common immunotherapy biomarkers in non-small-cell lung cancer patients. Current Oncology, vol. 29, no. 8, p. 5715-5730, 2022. https://doi.org/10.3390/curroncol29080451
[9] K. Lin, B. Rubinfeld, et al. Preclinical development of an anti-napi2b (slc34a2) antibody–drug conjugate as a therapeutic for non–small cell lung and ovarian cancers. Clinical Cancer Research, vol. 21, no. 22, p. 5139-5150, 2015. https://doi.org/10.1158/1078-0432.ccr-14-3383
[10] D. Gerber, J. Infante, et al. Phase ia study of anti-napi2b antibody–drug conjugate lifastuzumab vedotin dnib0600a in patients with non–small cell lung cancer and platinum-resistant ovarian cancer. Clinical Cancer Research, vol. 26, no. 2, p. 364-372, 2020. https://doi.org/10.1158/1078-0432.ccr-18-3965

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.
Gene References into Functions
  1. The upstream breakpoint lies in the same region as the breakpoint of a fused gene SLC34A2-ROS1, which encodes a constitutive kinase in the lung cancer cell line HCC78 and nonsmall-cell lung cancer (NSCLC), suggesting that the deletion in this family is a hot spot for recombination, not only in cancer samples with somatic mutation, but also in PAM patients with germline genetic defects of SLC34A2. PMID: 30262706
  2. SLC34A2 plays a crucial promoting role in colorectal cancer development. PMID: 29653487
  3. Studied expression of solute carrier family 34 member 2 (SLC34A2/NaPi2b) in epithelial ovarian cancer using monoclonal antibody MX35 and immunohistochemistry. Different staining intensities were observed in different grades of epithelial ovarian cancer. PMID: 28464843
  4. Low SLC34A2 expression is associated with non-small cell lung cancer. PMID: 26910912
  5. SLC34A2 has an important role in promoting proliferation and tumorigenicity of BC. PMID: 28151475
  6. SLC34A2 was down-regulated in osteosarcoma patients.SLC34A2 interacted with PTEN, and decreased the phosphorylation of PI3K and AKT, which inactivated the PI3K/AKT signaling pathway. PMID: 28777670
  7. High expression of SLC34A2 was identified in about 2/3 patients and correlated with significantly better patient's overall survival. Epidermal growth factor receptor mutations were detected in about 53% of patients with no statistically significant difference to patient's overall survival. Anaplastic lymphoma kinase rearrangement was found in 8 out of 175 patients, harboring this abnormality leads to shorter overall survi PMID: 28720066
  8. we elucidated that miR-939 exerted its function mainly through inhibiting SLC34A2/Raf/MEK/ERK pathway, which is activated in GC. Multivariate analysis identified miR-939, SLC34A2, and their combination as independent indicators for poor prognosis and tumor recurrence in GC patients. PMID: 28114937
  9. a novel role of SLC34A2 inbreast cancer stem cells (BCSCs) state regulation and establishes a rationale for targeting the SLC34A2/PI3K/AKT/SOX2 signaling pathway for breast cancer therapy. PMID: 28381172
  10. Knockdown of SLC34A2 inhibits proliferation. PMID: 28281971
  11. Our work sheds new light on the nature of the state of lung cancer stem cell-like cells and the role of SLC34A2 in the tumorigenicity of these cells PMID: 26846105
  12. our data indicated that SLC34A2 could exert significantly suppressive effects on tumorigenesis and progression of NSCLC. SLC34A2 might provide new insights for further understanding the early pathogenesis of human non-small cell lung cancer PMID: 26156586
  13. SLC34A2 might be associated with the initiation and progression of lung adenocarcinoma PMID: 25017204
  14. Data indicate that humanized monoclonal antibody Rebmab200 and murine monoclonal antibody MX35 monoclonal antibodies had similar specificity for sodium phosphate transporter NaPi2b. PMID: 23936189
  15. investigation revealed that the c.910A > T mutation in the SCL34A2 gene was responsible for pulmonary alveolar microlithiasis (PAM) patients in China PMID: 23164546
  16. identified 2 cases of pulmonary alveolar microlithiasis(PAM) with new mutations of SLC34A2 gene; identified the NaPi-IIb in a aortic valve; hypothesize that mutations in SLC34A2 may play a role in development of aortic valve calcification and arteriosclerosis PMID: 22336687
  17. a comprehensive analysis indicates that SCL34A2 is the only gene of the several phosphate transporters genes whose expression differentiates normal from carcinoma samples, suggesting it might exert a major role in ovarian carcinomas. PMID: 22553815
  18. The performed study revealed that SLC34A2 gene exhibited the most distinct change in expression and may become a molecular marker of papillary thyroid cancer PMID: 17091453
  19. study provides the data on the pattern of NaPi2b expression and cellular localization in breast, lung and ovarian cancers PMID: 21956469
  20. Upregulation of SLC34A2 gene expression in well-differentiated tumors may reflect cell differentiation processes during ovarian cancerogenesis and could serve as potential marker for ovarian cancer diagnosis and prognosis. PMID: 21716206
  21. There was a significantly increased gene expression of SLC34A2 (normal tissues: 6.71+/-0.77; tumour tissues: 10.29+/-0.80) among breast cancer tissues compared with normal tissues. PMID: 21036732
  22. In human lung alveolar epithelial cells, the content of calcium and phosphate in cell supernatant decreased with increased amount of SLC34A2 mRNA. PMID: 19134407
  23. study describes mutations in SLC34A 2 gene in an inbred Turkish family with three siblings diagnosed with pulmonary alveolar microlithiasis(PAM); findings suggest that impaired activity of the SLC34A2 gene may be responsible for familial PAM PMID: 20046000
  24. A novel mutation in exon 8 of the SLC34A2 gene were associated with pulmonary alveolar microlithiasis in Chinese pedigree. PMID: 20017296
  25. The current study was performed to characterize the minimal promoter region and transcriptional factor(s) necessary to activate gene expression of NaPi-IIb in human intestinal cells. PMID: 15458926
  26. Study identified a pulmonary alveolar microlithiasis locus by homozygosity mapping to 4p15, then identified, by a candidate-gene approach, the gene responsible for the disease as SLC34A2, which is involved in phosphate homeostasis in several organs. PMID: 16960801
  27. Mutations in the SLC34A2 gene that abolish normal gene function cause pulmonary alveolar microlithiasis. PMID: 17095743
  28. The monoclonal antibodies were shown to recognize specifically transiently overexpressed and endogenous NaPi2b in commonly used immunoassays. PMID: 18724815
  29. SLC34A2 is associated with sodium-lithium countertransport activity and blood pressure PMID: 19119262
  30. The gene responsible for PAM, SLC34A2, has been identified. It encodes a type IIb sodium-dependent phosphate transporter, the function of which provides an insight into the pathogenesis of this disease. PMID: 19617834

Show More

Hide All

Involvement in disease
Pulmonary alveolar microlithiasis (PALM)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
SLC34A transporter family
Tissue Specificity
Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.
Database Links

HGNC: 11020

OMIM: 265100

KEGG: hsa:10568

STRING: 9606.ENSP00000371483

UniGene: Hs.479372

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*