Recombinant Human Sodium/glucose cotransporter 1 (SLC5A1), partial

Code CSB-YP021675HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021675HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP021675HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP021675HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP021675HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
D22S675; High affinity sodium glucose cotransporter 1; High affinity sodium glucose cotransporter; High affinity sodium-glucose cotransporter; Human Na+/glucose cotransporter 1; Na(+)/glucose cotransporter 1; Na+/glucose cotransporter 1; NAGT; SC5A1_HUMAN; SGLT 1; SGLT1; SLC5A1; Sodium glucose cotransporter 1; Sodium/glucose cotransporter 1; Solute carrier family 5 (sodium/glucose cotransporter) member 1; Solute carrier family 5 member 1
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I have some questions regarding your product SLC5A1 recombinant protein (CSB-EP021675HU):
1)During the purification process of the SLC5A1 recombinant protein is detergent used? What kind? How much? Are there any detergent residues on the final product?
2)Is the protein in its native state or is it denatured?

A:
Very nice to receive your inquiry. This protein is a transmembrane protein with 13 times transmembrane domains. For the regular four expression systems such as E.coli, Yeast, Baculovirus and Mammalian cell, we only provide the fragment which doesn't contain the transmembrane region. So we don't use the detergent, and no detergent residues on the final products.
The information is listed as follow:
Recombinant Human Sodium/glucose cotransporter 1(SLC5A1),partial
CSB-YP021675HU >> Yeast
CSB-EP021675HU >> E.coli
CSB-BP021675HU >> Baculovirus
CSB-MP021675HU >> Mammalian cell
Expression Region: 564-643aa; Partial.
Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows:
YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

RNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRT


If you need the full length protein,we can provide risk-free service with cell free expression system, please check as follows:
Recombinant Human Sodium/glucose cotransporter 1(SLC5A1)
CSB-CF021675HU(A4)
Expression Region: 1-664 aa,full length protein.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag is: N-terminal 10xHis-tagged
Sequence:

MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFLAGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIYIKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLAIFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAIPTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQRCLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVGCTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEKELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRVNEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFITIVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKGIFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCHAYFA


Reference: http://www.uniprot.org/uniprot/P13866
If we can successfully express this protein, you need to pay corresponding fees and we will provide the purified protein.
If we are failed in expression this protein, you don't need to pay any fees. However you could pay for the gene synthesis and subcloning to purchase the constructed plasmid and strains if you need.
PS: The expression plasmid is not for sale if this project is successful.
We will use detergents during the expression of the full length transmembrane protein. For example, we usually use 0.05% Brij78. Please check if you have requst on further dialysis to remove detergents. In theory, such low level have little effect on proteins. Also conducive to the stability of the protein.
All protein purifications are purified under non-denaturing conditions. We purify them under very mild conditions by affinity chromatography, ion exchange, etc. to ensure that the final product buffer does not contain any denaturant components and try to make the protein structure and function is not damaged.

Target Background

Function
Actively transports glucose into cells by Na(+) cotransport with a Na(+) to glucose coupling ratio of 2:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.
Gene References into Functions
  1. Only the index variant in SLC5A1 showed a significant association with fasting glucose in the expected opposing direction. Products of genes in all 1,5-AG-associated loci have known roles in carbohydrate digestion and enteral or renal glucose transport, suggesting that genetic variants associated with 1,5-AG influence its concentration via effects on glucose metabolism and handling PMID: 28588231
  2. High glucose levels induce MMP-2 expression in Human cardiac fibroblasts , possibly by up-regulation of SGLT1. PMID: 29512713
  3. Data suggest that a fraction of sodium glucose transporter is rapidly degraded by lysosomes and never reached the plasma membrane; another fraction reaches the membrane and is subsequently degraded by lysosomes following internalization. PMID: 28193781
  4. Data suggest expression of SGLT1 is markedly increased in kidney of patients with type 2 diabetes as compared to control subjects; SGLT1 mRNA is highly and significantly correlated with fasting and postprandial plasma glucose and HbA1c. In contrast, data suggest SGLT2 and GLUT2 mRNA in kidney are down-regulated in type 2 diabetes, but not to statistically significant level. (GLUT2 = glucose transporter type 2) PMID: 28477418
  5. Data suggest that SGLT2 expression is higher in control kidney than in kidney from subjects with type 2 diabetes; SGLT1 expression in kidney tended in the same direction; SGLT2 appears to be localized to tubular brush-border membranes; unaffected renal tissues were obtained from subjects undergoing unilateral nephrectomy for renal carcinomas. PMID: 28419670
  6. Duodenal SGLT-1 expression is increased in individuals with 1-hour postload hyperglycemia or impaired glucose tolerance, as well as in subjects with T2 Diabetes mellitus, and it positively correlates with early postload glucose excursion. PMID: 28938485
  7. Homoeriodictyol affects both the glucose metabolism and the serotonin system in Caco-2 cells via a sodium glucose cotransporter 1 protein (SGLT-1)-meditated pathway. PMID: 28192456
  8. intracellular Na+ and sugar release occurs in a random, independent manner PMID: 27325773
  9. Sodium-Glucose Cotransporter (hSGLT1) Is a Disulfide-Bridged Homodimer with a Re-Entrant C-Terminal Loop PMID: 27137918
  10. JAK3 up-regulates SGLT1 activity by increasing the carrier protein abundance in the cell membrane, an effect enforcing cellular glucose uptake into activated lymphocytes and thus contributing to the immune response. PMID: 27595398
  11. Results found that SGLT1 is required for FLIPL induced cell aerobic glycolysis and survival to low glucose conditions. In patients with hepatocellular carcinoma, SGLT1 expression level was positively correlated with FLIPL expression level. PMID: 27178057
  12. Although the similarity between the pf values of SGLT1 and aquaporin-1 makes a transcellular pathway plausible, it renders water pumping physiologically negligible because the passive flux would be orders of magnitude larger. PMID: 26945065
  13. Elevated SGLT activity increases Na+ influx into myocytes and causes Na+ overload in type 2 diabetes. PMID: 26316524
  14. Compound K induces SGLT1 expression and glucose uptake in differentiated intestinal Caco-2 cells. PMID: 25600494
  15. phlorizin binding domains in sodium-glucose cotransporter family PMID: 26086341
  16. Data demonstrate a role for Per1 in the transcriptional regulation of NHE3 and SGLT1 in the kidney. PMID: 26377793
  17. Cardiac SGLTs, possibly SGLT1 in particular, appear to provide an important protective mechanism against ischemia-reperfusion injury by replenishing ATP stores in ischemic cardiac tissues. PMID: 26121582
  18. CREB activation is essential for EGF-induced SGLT1 gene expression. PMID: 25936754
  19. Gglucose galactose malabsorption...analysis lead to the identification of 2 novel mutations... PMID: 24048166
  20. Delphinidin-3-glucoside protects against oxidized low-density lipoprotein-induced mitochondrial dysfunction in vascular endothelial cells via the sodium-dependent glucose transporter SGLT1. PMID: 23874689
  21. The Na2 site is conserved in hSGLT1, the side chain of S392 and the backbone carbonyl of S393 are important in the first Na+ binding, and that Na+ binding to Na2 promotes binding to Na1 and also sugar binding. PMID: 24191006
  22. Data indicate that IGF-1R and SGLT1 interact in HEK293 and MCF7 cells, and IGF-1R siRNA transfection results in down-regulation of SGLT1. PMID: 23531874
  23. Results suggest that the use of MAP17 and SGLT1 markers may identify patients who are likely to exhibit a better response to treatments that boost oxidative stress in other cancer types. PMID: 23418532
  24. B-RAF upregulates SGLT1 activity, an effect requiring vesicle insertion into the cell membrane. PMID: 23010278
  25. in hSGLT1, pi-pi interaction between outer gate residues F101 and F453 contributes to holding the sugar in the occluded conformation after binding. PMID: 23116249
  26. A seven-state kinetic model is established that describes the activity of SGLT1 up to a 2 ms time resolution. PMID: 23008432
  27. SGLT1 overexpression, as examined by immunohistochemistry, is an independent biomarker for poor prognosis of patients with ovarian carcinoma. PMID: 22159627
  28. Expression of SGLT1 and EGFR in colorectal cancer tissues was higher than that in normal tissues and their expression related with clinical stage. PMID: 21080109
  29. Data suggest that "gate" residues in SGLT1 contribute directly to the coupling between substrate and Na+ transport PMID: 22159082
  30. the structural basis of cotransporter water permeability PMID: 22004742
  31. JAK2 upregulates SGLT1 activity which may play a role in the effect of JAK2 during ischemia and malignancy. PMID: 21406183
  32. An independent estimation of the turnover rate for human SGLT1 expressed in Xenopus laevis oocytes, was obtained applying the ion-trap technique. PMID: 21190656
  33. Glucose-galactose malabsorption is life-threatening newborn diarrhea caused by mutations in the Na(+) /glucose cotransporter gene SLC5A1 that described herein. PMID: 20486940
  34. HPV18 E6 oncoprotein participates in the upregulation of SGLT1. PMID: 21156162
  35. The role of SGLT1 and SGLT2 in renal glucose reabsorption are discussed. PMID: 20980548
  36. The role of SGLT1 and SGLT2 in renal glucose reabsorption, and the potential for targeting these transporters in diabetes there are discussed. PMID: 21048164
  37. This study indicates that the leak current associated with SGLT1 is mediated by a variety of monovalent cations, including cations that do not generate the conformational changes associated to the Na+ binding site used for cotransport. PMID: 20338844
  38. Mutations of this gene protein (mapped to Chromosome 22) causes glucose-galactose malabsorption in infants. Sugar transport is impaired mainly because the mutant proteins are either truncated or are not targeted properly to the cell membrane. PMID: 12139397
  39. Intracellular compartments containing SGLT1 are involved in the regulation of SGLT1 abundance at the apical cell surface. PMID: 12773314
  40. Aspartate residue 454 of SGLT1 is critically important for normal trafficking of the protein to the plasma membrane. PMID: 15476411
  41. Our results indicate that the major voltage-dependent step of the Na(+)/glucose transport cycle is the return of the empty carrier from inward to outward facing conformations. PMID: 15596535
  42. Thus, the C351A and C361A mutations might cause a global reorganization of the disulfide bonds of SGLT1. PMID: 15885653
  43. the large, hydrophilic loop near the carboxyl terminus of SGLT1 does not appear to play a major part in the binding of phlorizin PMID: 15904891
  44. SGLT-1 has a role in glucose uptake and in protecting intestinal epithelial cells against LPS-induced apoptosis and barrier defects PMID: 16260652
  45. 3 conformational states of SGLT1 differ in their packing density and surface hydrophobicity, reflecting the empty carrier, the d-glucose loaded carrier facing the outside of membrane and the complex of the outside-orientated carrier with phlorizin PMID: 16300400
  46. water transport across the membrane can be explained by cotransport of water in the membrane proteins and that intracellular unstirred layers effects are minute PMID: 16322051
  47. results indicate that cysteine residues C255 and C511 form a disulfide bridge in human SGLT1 and that this disulfide bridge is involved in the conformational change of the free carrier PMID: 16446504
  48. hRS1 protein exhibits glucose-dependent, short-term inhibition of hSGLT1 and hOCT2 by inhibiting the release of vesicles from the trans-Golgi network. PMID: 16788146
  49. description of a novel feedback mechanism in apoptotic signaling pathway for SGLT-1-dependent cytoprotection; observation suggests new function for CD14 on enterocytes involving induction of caspase-dependent SGLT-1 activity which leads to cell rescue PMID: 16860318
  50. study examines the conformations of the Na(+)/glucose cotransporter during sugar transport using charge and fluorescence measurements PMID: 17130520

Show More

Hide All

Involvement in disease
Congenital glucose/galactose malabsorption (GGM)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Sodium:solute symporter (SSF) (TC 2.A.21) family
Tissue Specificity
Expressed mainly in intestine and kidney.
Database Links

HGNC: 11036

OMIM: 182380

KEGG: hsa:6523

STRING: 9606.ENSP00000266088

UniGene: Hs.1964

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×