Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
SLCO2B1; KIAA0880; OATP2B1; OATPB; SLC21A9; Solute carrier organic anion transporter family member 2B1; Organic anion transporter B; OATP-B; Organic anion transporter polypeptide-related protein 2; OATP-RP2; OATPRP2; Solute carrier family 21 member 9
Species
Homo sapiens (Human)
Expression Region
461-564aa
Target Protein Sequence
FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer，50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of the recombinant Human SLCO2B1 protein begins with the creation of the recombinant plasmid, which is synthesized by inserting the gene encoding the Human SLCO2B1 protein (461-564aa) into a plasmid vector. The recombinant plasmid is introduced into e.coli cells. e.coli cells that can survive in the presence of a specific antibiotic are selected and then cultured under conditions conducive to the expression of the gene of interest. The protein is equipped with a N-terminal 10xHis tag and C-terminal Myc tag. Following expression, the recombinant SLCO2B1 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Human SLCO2B1 protein, demonstrating a purity exceeding 85%.
