Recombinant Human Solute carrier organic anion transporter family member 2B1 (SLCO2B1), partial

Code CSB-YP021746HUf3
Abbreviation Recombinant Human SLCO2B1 protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SLCO2B1
Uniprot No.
Research Area
Others
Alternative Names
SLCO2B1; KIAA0880; OATP2B1; OATPB; SLC21A9; Solute carrier organic anion transporter family member 2B1; Organic anion transporter B; OATP-B; Organic anion transporter polypeptide-related protein 2; OATP-RP2; OATPRP2; Solute carrier family 21 member 9
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
461-564aa
Target Protein Sequence
FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.7
Protein Length
Partial
Tag Info
C-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
Gene References into Functions
  1. PDZK1 directly interacts with OATP2B1 resulting in a change of the amount of transporter in the membrane, and thereby in an increased transport function. PMID: 29752999
  2. Report inhibition of organic anion-transporting polypeptide 2B1 by crude drug extracts used in Japanese traditional Kampo medicines. PMID: 29248449
  3. Significant interaction between SLCO2B1 genotypes and treatment over time for parasitemia clearance rate on day 2 were observed. PMID: 28975866
  4. It shows high expression of OATP2B1 mRNA in human pancreatic islets. PMID: 28815335
  5. genetic association studies in population in South Korea: Data suggest that an SNP in SLCO2B1 (c.935G>A, rs12422149) is associated with lipid-lowering response to rosuvastatin (an HMG-CoA reductase inhibitor) in subjects with hypercholesterolemia. PMID: 28627804
  6. The OATP2B1 was primarily found in beta cells, suggesting a distinct expression pattern for OATP1B3 and OATP2B1 in islets. PMID: 28493059
  7. results indicate that insulin acts on the small intestine to increase OATP2B1-mediated absorption PMID: 28318878
  8. Data show that prostaglandin E3 (PGE3) uptake by prostaglandin transporter OATP2A1-expressing HEK293 cells (HEK/2A1) was the highest and followed by SLCO2B1 (HEK/1B1). PMID: 26692285
  9. OATP2B1 contributes to the uptake of SN-38 by intestinal tissues, triggering gastrointestinal toxicity. PMID: 26526067
  10. The association of SNP rs1077858 with OS may be a result of differential SLCO2B1 expression and the consequent increased uptake of DHEAS and subsequent resistance to ADT, which, in turn, may contribute to decreased OS. PMID: 26668348
  11. Suggest that OATP2B1 is involved in cell proliferation by increasing the amount of estrogen in ER1-positive breast cancer cells. PMID: 25857231
  12. OATP2B1 as a determinant of pharmacokinetics in the coronary artery. PMID: 26091578
  13. These results suggest that OATP2B1 plays an important role in the stereoselective pharmacokinetics of fexofenadine and that one-time apple juice ingestion probably inhibits intestinal OATP2B1-mediated transport of both enantiomers PMID: 24903351
  14. The genotypes of the two other SLCOs,SLCO1B3 and SLCO2B1, did not show any association with bladder cancer susceptibility PMID: 24762081
  15. SLCO2B1 rs12422149 variants could provide prognostic value for prostate cancer patients treated with androgen deprivation therapy (ADT) and influence ethnic differences in response to ADT. PMID: 23896625
  16. SLCO2B1 polymorphisms do not affect the pharmacokinetics of montelukast and SLCO2B1 polymorphisms appear to be a minor determinant of inter-individual variability of montelukast. PMID: 23970434
  17. the major OATP2B1 protein form in liver is transport competent and its hepatic expression is regulated by HNF4alpha. PMID: 23531488
  18. SLCO2B1 c.935G>A single nucleotide polymorphism has no effect on the pharmacokinetics of montelukast and aliskiren. PMID: 23151832
  19. Report flavonoid components in grapefruit, orange, and apple juices responsible for OATP2B1-mediated drug interactions. PMID: 23132664
  20. in end-stage renal failure patients, some uremic toxins are related to the downregulation of intestinal MRP2 and hepatic OATP1B1 and/or OATP2B1 PMID: 23190519
  21. The selective hepatic uptake of scutellarin mediated by OATP2B1 is likely a key determinant of its unique pharmacokinetic characteristics. PMID: 22822035
  22. Data suggest the OATP2B1 has multiple binding sites for endogenous steroids, dietary flavones, and drugs; the binding sites vary in affinity for ligands. PMID: 22201122
  23. OATP2B1 represents a low-affinity transport route for antifolates at low pH. In contrast, the high affinity of this transporter for sulfobromophthalein seems to be intrinsic to its binding site and independent of pH. PMID: 22021325
  24. investigation of vectorial transport across enterocytes: Data from Caco-2 cells, models of intestinal absorption, suggest that OATP2B1 mediates apical fexofenadine/zwitterion uptake. Recombinant OATP2B1 mediates fexofenadine uptake in MDCKII cells. PMID: 21780830
  25. The biologic function of a SLCO2B1 coding SNP in transporting androgen was examined. 3 SNPs in SLCO2B1 were associated with time to progression in androgen-deprived prostatic cancer patients. PMID: 21606417
  26. SLCO2B1 is a major transporter for montelukast and pharmacokinetics were affected by SLCO2B1 genotype and not fruit juice. PMID: 20974993
  27. Six SLCO genes were highly expressed in castration resistane prostate cancer metastases versus untreated prostate cancer, including SLCO1B3 and SLCO2B. PMID: 21266523
  28. tissue-specific localization of OATP2B1, OATP3A1 and OATP5A1 has been analyzed in normal mammary tissue and corresponding breast cancer tissues. PMID: 21278488
  29. Is present in high frequencies in the finnish population PMID: 20560925
  30. OATP2B1/SLCO2B1 function is modulated by protein kinase C-mediated internalization PMID: 20159975
  31. uptake of steroid sulfates by isolated trophoblasts is mediated by OATP-B and OAT-4 suggesting a physiological role of both carrier proteins in placental uptake of fetal-derived steroid sulfates. PMID: 12409283
  32. The trafficking and function of OATP2B1 is vulnerable to changes in the cysteine residues of extracellular loop IX-X. PMID: 16754786
  33. The results indicate functional modification of OATP2B1-mediated estrone-3-sulfate and dehydroepiandrosterone-sulfate as well as pregnenolone sulfate transport through steroid hormones such as progesterone. PMID: 16908597
  34. Functional differences in steroid uptake of SLC22A9 and SLC02B1 in human placenta are reported. PMID: 18501590
  35. OATP2B1 is an uptake transporter expressed in platelets and is involved in statin-mediated alteration of platelet aggregation PMID: 19237515
  36. Results describe the transcription of the OATP2B1 gene (SLCO2B1) in 14 different human tissues by means of 5'-RACE analysis. PMID: 19383542
  37. OATP2B1 -282G > A is a major factor affecting expression, suggesting a contribution to inter-individual differences in the expression level of OATP2B1 in human liver PMID: 19620935

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Organo anion transporter (TC 2.A.60) family
Tissue Specificity
Isoform 1 has it's highest expression in brain, it is the major form expressed in duodenum, kidney, placenta, and skeletal muscle. Isoform 3 predominates in liver.
Database Links

HGNC: 10962

OMIM: 604988

KEGG: hsa:11309

STRING: 9606.ENSP00000289575

UniGene: Hs.7884

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*