Recombinant Human Somatostatin receptor type 5 (SSTR5), partial

Code CSB-EP022728HU1
Abbreviation Recombinant Human SSTR5 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
307-364aa
Target Protein Sequence
LSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQTSKL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
8.0 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization.
Gene References into Functions
  1. Somatostatin receptor 5 variant (sst5TMD4) was expressed in a subset of breast cancers, where it correlated with angiogenic markers, lymphatic metastasis, and reduced disease-free survival. PMID: 27507050
  2. sst5TMD4 is overexpressed in PCa, especially in those patients with a worse prognosis, and plays an important pathophysiologic role in PCa, which suggesting its potential as a biomarker and/or therapeutic target PMID: 28705809
  3. In cotransfected HEK-293 cells, SSTR5 and CB1R existed in a constitutive heteromeric complex under basal condition, which was disrupted upon agonist treatments. Furthermore, concurrent receptor activation led to preferential formation of SSTR5 homodimer and dissociation of CB1R homodimer. PMID: 27984180
  4. A truncated splice variant of the somatostatin receptor subtype 5, is associated to features of increased aggressiveness in pancreatic neuroendocrine tumors. PMID: 26673010
  5. SSTR5 was the predominantly expressed receptor subtype in the cytoplasm of all GH-secreting adenomas tested, regardless of whether they came from octreotide-naive, octreotide-responsive, or octreotide-resistant patients. SSTR5 mRNA predominance was significant only in octreotide treated patients. Its expression was not correlated with baseline or post-octreotide GH or IGF-1 levels or tumor volume. PMID: 25008035
  6. This is the first evidence indicating that sst5TMD4 is expressed in human medullary thyroid carcinoma cells, where it associates with more aggressive behavior, suggesting that sst5TMD4 might play a functionally relevant role. PMID: 25854304
  7. A truncated sst5-variant (sst5TMD4) can influence the secretory response of somatotropinomas to somatostatin analogues-therapy. PMID: 25637790
  8. SSTR5 protein is overexpressed in poorly differentiated thyroid cancer and may be involved in the lack of response to somatostatin analogue treatment. PMID: 24465589
  9. High SSTR5 expression is associated with gallbladder cancer. PMID: 23991955
  10. agonist-selective phosphorylation of carboxyl-terminal Threonine 333 of Sst5, is reported. PMID: 23418396
  11. Report down-regulation of SSTR-5 expression in operable hepatocellular carcinomas. PMID: 22640914
  12. Except for SSTR5, all SSTRs showed a tendency toward decreased expression in well-to poorly differentiated neuroendocrine carcinoma of the lung. PMID: 22770972
  13. Determination of the expression of SSTR5 in an attempt to establish correlations and/or associations with clinical characteristics of patients with nonfunctioning pituitary adenomas. PMID: 22419713
  14. The rabbit monoclonal antibodies UMB-4 and UMB-1 will facilitate the assessment of the somatostatin receptor status of human tumors during routine histopathological examinations. PMID: 21952553
  15. SSTR5 P335L is a hypofunctional protein with a potentially harmful effect on function, as well as potential latent effect, and therefore it could affect the clinical response to somatostatin analog therapy for patients with pancreatic cancer. PMID: 21249361
  16. Our results demonstrate a previously undetected strong association of two SSTR5 single nucleotide polymorphisms with acromegaly PMID: 21810856
  17. ZDHHC5 and SSTR5 are colocalized at the plasma membrane and coexpression of ZDHHC5 increased palmitoylation of SSTR5 whereas knock-down of endogenous ZDHHC5 by siRNAs decreased it. PMID: 21820437
  18. differential gene expression profiles revealed more abundant mRNA expression in ectopic ACTH syndrome than in Cushing disease of SSTR-5 PMID: 21383526
  19. data suggest that SSTR5 genetic variants play a role in pancreatic cancer development and progression PMID: 21692047
  20. demonstrate that cells transfected with SSTR1 or SSTR1/5 negatively regulates EGF mediated effects attributed to the inhibition of EGFR phosphorylation. PMID: 21419811
  21. The heterodimerization of somatostatin receptor-5 not only indicate the receptor's specificity of interaction but also provide new insight to understand the molecular mechanism in regulation of signaling pathway in receptor specific manner. PMID: 21238583
  22. These data indicate that the activation and/or overexpression of SST receptors along with the inhibition of EGFR will serve as an important therapeutic approach in the treatment of ErbB-positive tumors. PMID: 21190959
  23. Common genetic variation in the IGF1 and SSTR5 genes seems to influence circulating IGF-I levels PMID: 20810604
  24. This study demonstrated negative immunoreactivity for SSTR-5 in the adenomatous tissue. PMID: 19894022
  25. importance of Asn13 and/or Asn26 residues in the agonist-specific signalling of hSSTR5 PMID: 20207824
  26. Potential role of SSTR5 in the response of some tumors to somatostatin receptors. PMID: 20233783
  27. SSTR5 and CCR7 have a role in Crohn's disease pathogenesis PMID: 20150960
  28. identified an upstream promoter of the somatostatin receptor 5 gene with tissue-specific activity PMID: 12072395
  29. the SSTR5 gene is involved in the etiology of bipolar affective disorder or may exist in linkage disequilibrium with a susceptibility gene close to SSTR5. PMID: 12192619
  30. Results do not suggest the SSTR5 gene as a susceptibility gene for autism PMID: 12898583
  31. activation of hSSTR5 but not hSSTR1 is necessary for heterodimeric assembly PMID: 15247250
  32. role for SSTR5 t-461c and c1004t alleles in influencing GH and IGF-I levels in patients with acromegaly, whereas SSTR2 and SSTR5 variants seem to have a minor role in determining the responsiveness to somatostatin analogs PMID: 15914528
  33. intracellular sorting of the somatostatin receptor subtype 5 is regulated by interactions with PDZ domain proteins PIST/GOPC and PDZK1 PMID: 16012170
  34. Results suggest that the expression pattern of dopamine receptor 2 and somatostatin receptor 5 may influence the effects of SRIF analogs in growth hormone-secreting pituitary adenomas. PMID: 16216913
  35. The expression of SSTR5 in TSHoma may be a useful marker for predicting the outcome of octreotide therapy. PMID: 17159301
  36. The majority of all benign, premalignant and malignant laryngeal specimens expressed moderate to high levels of expression of SSTR5. PMID: 18066572
  37. Immunohistochemistry stufy of SSTR5 in prostate tissue from patients with bladder outlet obstruction showed that close to 90% of secretory cells showed a weak positivity in the cytoplasm. PMID: 18936524
  38. SSTR5 mRNA levels in Cushing disease were greater than silent corticotroph adenoma (SCA) but did not differ between non-functioning pituitary tumor and SCA. PMID: 19318729
  39. investigation of the role of BBXXB and DRY motifs of SST5 in the transduction of intracellular signals involved in the regulation of GH secretion and cell proliferation PMID: 19342453
  40. The existence of two previously unidentified sst5 spliced variants with distinct distribution in normal tissues and pituitary tumors. PMID: 19401364
  41. Genetic variation in the SSTR5 gene and, particularly, the rs4988483 single nucleotide polymorphism influence circulating IGFI and IGFBP3 hormone levels with no measurable effect on prostate cancer risk. PMID: 19423539

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary.
Database Links

HGNC: 11334

OMIM: 182455

KEGG: hsa:6755

STRING: 9606.ENSP00000293897

UniGene: Hs.449840

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*