Recombinant Human Sulfotransferase 2A1 (SULT2A1)

Code CSB-YP022942HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022942HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022942HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022942HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022942HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
SULT2A1
Uniprot No.
Alternative Names
Sulfotransferase 2A1; ST2A1; EC 2.8.2.2; Bile salt sulfotransferase; EC 2.8.2.14; Dehydroepiandrosterone sulfotransferase; DHEA-ST; DHEA-ST8; Hydroxysteroid Sulfotransferase; HST; ST2; SULT2A3; SULT2A1 HST STD
Species
Homo sapiens (Human)
Expression Region
1-285
Target Protein Sequence
MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. Mediates the sulfation of a wide range of steroids and sterols, including pregnenolone, androsterone, DHEA, bile acids, cholesterol and as well many xenobiotics that contain alcohol and phenol functional groups. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Plays an important role in maintening steroid and lipid homeostasis. Plays a key role in bile acid metabolism. In addition, catalyzes the metabolic activation of potent carcinogenic polycyclic arylmethanols.
Gene References into Functions
  1. Kinetic analyses showed further differential catalytic efficiency and substrate affinity of the SULT2A1 allozymes, in comparison with wild-type SULT2A1. These findings provided useful information concerning the effects of genetic polymorphisms on the sulfating activity of SULT2A1 allozymes. PMID: 29671343
  2. Polymorphisms of SULT2A1 gene is not associated with attention-deficit/hyperactivity disorder. PMID: 28367959
  3. nine human SULT2A1 allozymes plus the wild-type SULT2A1 were found to display differential sulfating activity toward DHEA and tibolone. Kinetic analysis revealed that different SULT2A1 allozymes exhibited differential substrate affinity and catalytic efficiency toward the two substrates tested. PMID: 29392568
  4. Mass spectrometry analysis and structural modeling supported a reaction mechanism which involves the isomerization of Delta(4)-3-ketosteroids from the keto form to an enol form, prior to being subjected to sulfation. Results derived from this study suggested a potential role of SULT2A1 as a Delta(4)-3-ketosteroid sulfotransferase in steroid metabolism PMID: 28782626
  5. A theoretical study at the level of density functional theory (DFT) was performed to characterize noncovalent intermolecular interactions, especially hydrogen bond interactions, in the active site of enzyme human androsterone sulphotransferase. PMID: 27337388
  6. Decreased SULT2A1 activity was found in the adrenal zona reticularis in Alzheimer's disease patients. PMID: 26680489
  7. PSC is characterized by disease-specific impairment of SULT2A1 expression following PXR activation, a phenomenon which is not noted in PBC, and may account for the impaired hepatoprotection in PSC. PMID: 26504856
  8. It metabolizes breast cancer drugs like afinoxifene and endoxifen by sulfation. PMID: 26169578
  9. The substrate, such as lithocholic acid (LCA), participated in regulating the structure and flexibility of sulfotransferase actively rather than merely being selected passively. PMID: 26149755
  10. Our results show that SULT2A1 is important in the first trimester; particularly in the adrenals PMID: 25802089
  11. molecular dynamic simulations were used to investigate the effect of ligands (cofactor and substrate) on the thermo-denaturation process of hSULT2A1 PMID: 25750022
  12. results established human SULT2A1 as a novel LXRalpha target gene; the expression of LXRalpha is a potential predictor for the expression of SULT2A1 in human liver PMID: 25028566
  13. It turns out the protective effect of DHEA was significantly decreased when Wnt/beta-catenin signaling was activated, while inactivating Wnt/beta-catenin signaling enhanced the effects of DHEA PMID: 25065588
  14. The complete kinetic mechanism of human SULT2A1. PMID: 25056952
  15. Fetal inflammatory response syndrome and funisitis are associated with an elevation of umbilical cord plasma concentrations of soluble sulfotransferase (ST)2. PMID: 23488731
  16. Depression following hip fracture with poor long term recovery is associated with a higher serum cortisol:DHEAS ratio. PMID: 23773910
  17. Genetic variants in SULT2A1 do not predispose to polycystic ovary syndrome. Although a variant in SULT2A1 decreased the DHEAS to DHEA ratio, no changes in other androgenic hormone levels were observed. PMID: 23861462
  18. formation of disulfide bonds in hSULT2A1 is a potentially important reversible mechanism for alterations in the rates of sulfation of both endogenous and xenobiotic substrates PMID: 23444386
  19. These data show an age-related association of polymorphisms in the SULT2A1 gene with lower dehydroepiandrosterone sulfate, suggesting that these polymorphisms may affect dehydroepiandrosterone sulfate concentration in adults. PMID: 23436881
  20. SULT2A1 as a novel ROR-alpha and ROR-gamma target gene. PMID: 23211525
  21. Genetic variants of SULT2A1 do not appear to have an effect on individual DHEA and DHEAS concentrations or the DHEA/DHEAS ratio as a marker of DHEA sulfonation capacity PMID: 23132913
  22. A crystallographic and biochemical description of the molecular linkages that couple nucleotide binding and SULT2A1 isomerization. PMID: 23362278
  23. The simulations predict that the active-site "cap," which covers both the nucleotide and acceptor binding sites, opens and closes in response to nucleotide. PMID: 23256751
  24. Common polymorphisms at POR, SULT2A1 or HSD11B1 were not associated with PA in a Finnish Caucasian population. PMID: 22445027
  25. Serum DHEAS levels are increased in patients with non-alcoholic fatty liver disease with elevated alanine aminotransferase levels. PMID: 21841322
  26. Hydroxysteroid sulfotransferase SULT2A1 is suppressed by the estrogen related receptor alpha PMID: 21513704
  27. The sulfation kinetics of dehydroepiandrosterone and 15 human bile acids by SULT2A1, was characterized. PMID: 20102295
  28. Crystal structure of human dehydroepiandrosterone sulphotransferase in complex with substrate PMID: 11988089
  29. Both steroidogenic factor 1 and GATA-6 were positive regulators of SULT2A1 promoter constructs PMID: 15388788
  30. lowered expression in hepatocellular carcinoma tissues involved in metabolism and/or inactivation of sex steroids is consistent with a regulatory role SULT2A1 in the development and/or tumor cell differentiation and progression of human HCC PMID: 15713538
  31. Estrogen receptor alphaeffects on SULT2A1 were greater than the stimulation seen in response to steroidogenic factor 1 (SF1). PMID: 15878968
  32. The SULT2A1 is the major endogenous enzyme responsible for sulfation of the tibolone metabolites in human postmenopausal tissues. PMID: 16360722
  33. the SULT2A1 gene is mediated by SF1 and indirectly regulated by T(3) PMID: 16469813
  34. No significant association of the presence of the different SULT2A1 alleles with the occurrence of prostate cancer in black men was detected. PMID: 16617014
  35. Methotrexate induction of hSULT2A1 is mediated through hCAR. PMID: 17276571
  36. genetic evidence suggesting a potential role of SULT2A1, but not STS, in the inherited adrenal androgen excess of polycystic ovary syndrome PMID: 17426092
  37. Two amino acids are identified and characterized for the substrate inhibition of SULT2A1. PMID: 18042734
  38. In cortices attached to adrenocortical adenomas, SULT2A1 mRNA expression was present mainly in zona reticularis and extended to zona fasciculata. PMID: 18505908
  39. Sulfation of polychlorinated phenols catalyzed by hSULT2A1 may be a significant component of their metabolism in humans. PMID: 18656962
  40. Testosterone and insulin appear to be modulators of adrenal androgen production in this human adrenocortical cell model. PMID: 18684447
  41. Demonstrate that hSULT2A1 is responsible for the N-sulfation of quinolones and possibly other therapeutic drugs in humans. PMID: 19420132

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Sulfotransferase 1 family
Tissue Specificity
Liver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney.
Database Links

HGNC: 11458

OMIM: 125263

KEGG: hsa:6822

STRING: 9606.ENSP00000222002

UniGene: Hs.515835

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1