Recombinant Human TP53-regulated inhibitor of apoptosis 1(TRIAP1)

Code CSB-EP024443HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O43715
Relevance Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space to provide PA for CL synthesis in the inner membrane. Likewise, the TRIAP1:PRELID3A complex mediates the transfer of phosphatidic acid (PA) between liposomes (in vitro) and probably functions as a PA transporter across the mitochondrion intermembrane space (in vivo). Mediates cell survival by inhibiting activation of caspase-9 which prevents induction of apoptosis
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Protein 15E1.1 WF-1 p53-inducible cell-survival factor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
Research Area Cell Biology
Source E.coli
Gene Names TRIAP1
Protein Names Recommended name: TP53-regulated inhibitor of apoptosis 1 Alternative name(s): Protein 15E1.1 WF-1 p53-inducible cell-survival factor Short name= p53CSV
Expression Region 1-76aa
Tag Info N-terminal GST-tagged
Mol. Weight 35.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1
Subcellular Location Cytoplasm, perinuclear region, Mitochondrion, Mitochondrion intermembrane space
Protein Families TRIAP1/MDM35 family
Database Links

HGNC: 26937

OMIM: 614943

KEGG: hsa:51499

STRING: 9606.ENSP00000449795

UniGene: Hs.69499

Related Products

TRIAP1 Antibodies

TRIAP1 Antibodies for Human

TRIAP1 Proteins

TRIAP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.