Recombinant Human Telomerase reverse transcriptase(TERT),partial

In Stock
Code CSB-EP023391HU
Size US$2062Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names TERT
Uniprot No. O14746
Research Area others
Alternative Names CMM9; DKCA2; DKCB4; EST2; HEST2; htert; hTRT; PFBMFT1; TCS1; Telomerase associated protein 2; Telomerase catalytic subunit; Telomerase reverse transcriptase; Telomerase-associated protein 2; Telomere Reverse Transcriptase; TERT; TERT_HUMAN; TP2; TRT
Species Homo sapiens (Human)
Source E.coli
Expression Region 281-436aa
Target Protein Sequence EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 22.7kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex-associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis.
Gene References into Functions
  1. Results not only identify quadruplex formation in the first exon promoted by CpG dinucleotide methylation as a regulator of hTERT expression but also provide a possible mechanistic insight into the regulation of gene expression via secondary DNA structures. PMID: 29084850
  2. Findings indicate a critical role for hTERT in regulating the epigenetic clock, in addition to its established role of compensating for cell replication-dependent telomere shortening. PMID: 29374233
  3. CTC1-STN1 terminates TERT while STN1-TEN1 enables C-strand synthesis during telomere replication in colon cancer cells. PMID: 30026550
  4. Results show that TERT promoter (TERTp) mutations were detected in 8.5% of papillary thyroid carcinomas (PTCs) with the C228T mutation being the most frequent. Moreover, three novel TERTp alterations were identified, which may play a role in PTC aggressiveness. Also, TERTp hotspot mutations were highly correlated with BRAF V600E mutation and their coexistence was significantly associated with gender and advanced stage. PMID: 30200646
  5. Presence of TERT promoter mutation is associated with shorter progression free survival and overall survival in meningiomas WHO grade II and III PMID: 29808339
  6. These data suggest that genetic and epigenetic alterations of TERT are associated with TERT upregulation and may predict clinical outcomes in and young adults melanoma. PMID: 28378855
  7. We further characterized those epitopes using enzyme-linked immunosorbent assay, and here we discuss the critical epitope of an anti-TERT mAb, which is applicable for immunohistochemical analysis PMID: 30004263
  8. TERT-p in spitzoid lesions is not necessarily a predictor of poor prognosis PMID: 27930864
  9. there is an association between TERT promoter mutations and MC1R variants in melanoma patients PMID: 27930874
  10. The results indicate that the association with chr5p15.33-Region 2 may be explained by rs36115365, a variant influencing TERT expression via ZNF148 in a manner consistent with elevated TERT in carriers of the C allele. PMID: 28447668
  11. The identified uncommon TERT promoter mutations exacerbate the poor prognosis characteristic of ovarian clear cell carcinoma cases, and the hotspot mutations appear to be a molecular feature of the adenofibroma-associated form of the disease. PMID: 29474637
  12. hTERT contains a BH3-like motif, a short peptide sequence found in BCL-2 family proteins, and interacts with anti-apoptotic BCL-2 family proteins MCL-1 and BCL-xL PMID: 29937479
  13. TERT mutation predicted malignant behavior in three cases of follicular thyroid tumors. PMID: 29860621
  14. the combination of the TERT promoter/BRAFV600E mutations and Ki-67 LI is a promising marker to predict recurrence of PTC. PMID: 28150740
  15. our study verified the correlations of TGFBR2 and hTERT in vitro and suggests that TGFBR2 and hTERT expression may be used as a diagnostic biomarker for cervical dysplasia and carcinoma. PMID: 28195144
  16. epigenetic alterations of the TERT promoter are frequent and associated with advanced disease and poorer clinical outcome in adrenocortical carcinoma. PMID: 29956721
  17. TERT promoter mutations are conserved in the majority of morphologically, spatially and temporally distinct components of a given urothelial carcinoma PMID: 28741734
  18. hTERT Genetic Polymorphisms and Leukocyte Telomere Length Shortenings are associated with Childhood Acute Lymphoblastic Leukemia. PMID: 29936725
  19. TERT Promoter Mutation and Telomere Length is associated with Salivary Gland Tumors. PMID: 28664476
  20. hTERT promoter methylation status revealed non-significant trend towards increase in methylation frequency in head and neck cancer patients compared to healthy individuals. PMID: 30088231
  21. TERT could induce thyroid carcinoma cell proliferation mainly through the PTEN/AKT signaling pathway. PMID: 29901196
  22. There was significant prognostic difference among the 4 glioma subtypes. Combined IDH and TERT gene mutation analysis may be useful for prognostic subgrouping. Notably, IDH1 wild-type cases can be further subdivided into TERT(+ ) or (-) subgroups with significant prognostic difference. PMID: 30220117
  23. EGF significantly upregulated RFPL3 and hTERT protein levels in the nonsmall cell lung cancer cells. RFPL3 and hTERT proteins upregulation by EGF were attenuated by pretreatment with AG1478 and erlotinib. EGF promoted proliferation and inhibited apoptosis; PD98059 decreased RFPL3 and hTERT protein expression; and RFPL3 overexpression increased the expression of hTERT and related MEKpathway proteins PMID: 29749533
  24. TERT protein expression may be regulated by several mechanisms in addition to its promoter mutation. PMID: 29693015
  25. Letter: TERT promoter mutation is a genetic cognate of urothelial papilloma, papillary urothelial neoplasm of low malignant potential and urothelial carcinoma, further supporting the hypothesis that TERT mutation is a frequent and early step in the transformation of many urothelial neoplasms. PMID: 28040359
  26. hTERT promoter mutations associate with aggressive histopathological features, indicating a role in tumour progression in solitary fibrous tumours. PMID: 29703757
  27. Here it was found that there was no statistical difference between human TERT rs2736109 G>A, rs2735940 T>C, rs2853669 A>G, rs2736098 G>A, and rs2736100 T>G polymorphisms that can be associated with risk of Breast Cancer in a Turkish population. PMID: 29506639
  28. the TERT promoter mutation may serve as a biomarker of prognostic stratification in patients with papillary urothelial neoplasm of low malignant potential PMID: 29193225
  29. TERT promoter mutations are very rare in urachal adenocarcinomas (unlike in urothelial carcinoma). PMID: 29047227
  30. Binary logistic regression analysis showed significant association of TERT rs2736100C with gallbladder carcinoma risk. PMID: 29450669
  31. We found that THOR is hypermethylated in pancreatic tumor tissue when compared with normal tissue and that THOR methylation correlates with TERT expression in tumor samples. Our preliminary findings support the diagnostic and prognostic values of THOR in pancreatic cancer. PMID: 29019414
  32. TERT structural rearrangements are associated with metastatic pheochromocytomas. PMID: 28974544
  33. occurrence of TERT promoter mutations has a pivotal role in the disease progression as a secondary genetic event at a time when tumor cells face the need for telomere elongation to allow further proliferation. PMID: 29463038
  34. TERT rs2736098: G>A genotype distribution did not differ significantly between patients with DLBCL and controls. PMID: 28967095
  35. that the rs401681 polymorphism in the TERT-CLPTM1L locus contributes to lung carcinogenesis only in patients harboring an EGFR mutation PMID: 29033187
  36. Mutated Liquid-based FNAs BRAF, N/HRAS and TERT mutations were significantly associated with malignancy regardless of the cytological classification PMID: 29094776
  37. TERT promoter mutations were likely to occur in BRAF V600E positive thyroid cancer. Patients with these 2 combined mutations were more likely to have a poor prognosis and outcome. PMID: 30024548
  38. maternal genetic variations in hTERT may play a contributory role in risk of PTL and PPROM PMID: 29771920
  39. the mutational status of BRAF, NRAS, and TERT promoter genes in 97 melanomas, was investigated. PMID: 29061376
  40. PSMA, TERT, and PDEF may serve as a reference for clinical diagnosis and as potential targets for the malignant tumor of the prostate therapeutics PMID: 28829509
  41. In chronic kidney disease patients, telomerase activity in PBMC was positively correlated with the CKD stage, serum creatinine, potassium and parathormone levels, and negatively correlated with estimated glomerular filtration rate, body mass index, platelet count and serum calcium levels. PMID: 28705647
  42. experimental evidence for association of higher plasma levels of hTERT with overall survival of both low and high grade patients, presenting hTERT as an independent prognostic marker. PMID: 28756592
  43. Tumor suppressor functions of MCPH1/BRIT1 and BRCA1; links with the inactivation of the functional form of hTERT and the activation of dominant negative splice variants of hTERT. PMID: 29860064
  44. results reveal that TERT promoter mutations may contribute significantly to biomarker-based classification of malignant gliomas. PMID: 28868656
  45. Although Genome-Wide Association studies have not been carried out in the field of alcohol-related hepatocellular carcinoma (HCC), common single nucleotide polymorphisms conferring a small increase in the risk of liver cancer risk have been identified. Specific patterns of gene mutations including CTNNB1, TERT, ARID1A and SMARCA2 exist in alcohol-related HCC. [review] PMID: 28296015
  46. Mutation frequency in promoter region in non-acral cutaneous metastatic melanoma. PMID: 27301352
  47. a papillary carcinoma harboring TERT promoter mutation is at higher risk for anaplastic transformation PMID: 28731042
  48. Meta-analysis: The combination of BRAF and TERT promoter mutations could classify PTCs into four distinct risk groups with decreasing aggressiveness as follows: coexisting BRAF and TERT > TERT alone=BRAF alone > no mutations. PMID: 28666074
  49. A total of 13 articles and 15 case-control studies, including 9,157 cases and 11,073 controls, were included in this meta-analysis. Overall, the pooled results indicated that the rs2853669 polymorphism was significantly associated with increased cancer risk in a homozygote comparison model. PMID: 29534075
  50. Authors identified two cancer-specific methylation sites (CpG1 and 2) in the TERT promoter in tumors from GIC patients. Methylated TERT promoter CpG sites 1 and 2 were detectable in patient stool, while only background levels were observed in healthy individuals. PMID: 28754720
  51. TERT rs2736100 polymorphism is associated with cancer. PMID: 28418878
  52. Data indicate telomerase promoter (TERTp) mutations in pancreatic endocrine tumors (PETs) and PET-derived cell lines and serve as an alternative lengthening of telomeres (ALT) mechanism. PMID: 27411289
  53. These data indicated the participation of EndoG in alternative mRNA splicing of the telomerase catalytic subunit hTERT, regulation of telomerase activity and determination of cell fate. PMID: 28886883
  54. study detected an association between shorter peripheral blood telomeres and NAFLD-HCC (nonalcoholic fatty liver disease-hepatocellular carcinoma) development, and found that rare germline mutations in hTERT seems predispose to NAFLD progression to HCC PMID: 28677271
  55. Our results demonstrate that telomerase activity and hTERT gene expression were higher in aneuploid than in euploid cells. In addition, AZT exerted time- and dose-dependent cytotoxic effects on both aneuploid and euploid cells, and aneuploid cells were more sensitive to AZT-induced cytotoxicity. PMID: 28627647
  56. of CDX2 using a hypoxia-inducible hTERT promoter-driven vector suppressed malignant progression of colon cancer cells in vitro and in vivo.These results suggest that pLVX-5HRE-hTERTp-CDX2-3FLAG gene therapy may be a promising novel approach to treat colon cancer PMID: 28627695
  57. In multivariate analysis, CD34(+) cell telomere length was not associated with the clinical outcome (b=3.306, p=0.540). While hTERT expression was undetectable in all leukapheresis products, 94.4% of the CD34(+) enriched cell products expressed hTERT. Higher CD34(+)hTERT expression was associated with a better clinical outcome on univariate analysis (b=87.911, p=0.047). PMID: 28636901
  58. Study suggests that somatic TERT promoter mutations could play a vital role in the pathogenesis and progression of oral cavity squamous cell carcinoma. PMID: 28230921
  59. The results of this study suggest that TERT promoter and EIF1AX mutations are not frequently involved in FNMTC aetiology. However, study shows for the first time that TERT alterations are associated with familial thyroid tumour progression. The data also suggest that TERT mutations are more often found in concomitance with BRAF mutations in advanced stages of FNMTC. PMID: 28502101
  60. Mutations in the promoter of TERTp are common in patients with glioblastomas (GBMs) and oligodendrogliomas (ODGs). Mutations in IDH1 and MGMTp methylation and age under 55 were associated with favorable prognosis in diffuse gliomas and in cases with grade III AA (combined IDH-mutant and IDH-WT AA), TERTp mutant carriers had worse overall survival than TERTp WT carriers. PMID: 28851427
  61. Telomerase activation may serve an important role in myocardial infarction, in part, via the regulation of Src, Fyn and olfactory receptor family associated genes. PMID: 28713962
  62. A meta-analysis shows that TERT promoter mutations are closely associated with aggressive clinicopathological characteristics and poorer prognosis in papillary thyroid cancer. PMID: 27833153
  63. Imaging biomarkers for prediction of TERT mutation status remain weak and cannot be derived from the VASARI protocol. Tumor-associated seizures are less common in TERT mutated glioblastomas. PMID: 28894890
  64. TERT protein expression and telomerase activity are significantly decreased in senescent human dermal fibroblasts and reduction in the soluble fraction was more pronounced than in the DNA-bound one, suggesting the importance of the non-canonical functions of TERT in cell senescence. PMID: 28251405
  65. We demonstrated that PNA (Peptide Nucleic Acid )clamping has a higher sensitivity than DS for detecting oncogenic alterations in NSCLC ( non-small cell lung cancer ). Our findings suggest that PNA clamping is a more useful method for clinical practice. PMID: 29436188
  66. Telomerase reverse transcriptase promoter-mutated papillary thyroid cancer could be suggested by the ultrasonographic features of nonparallel orientation and microlobulated margin in patients older than 50 years PMID: 28616852
  67. Although hsa_circ_0020397 did not influence miR-138 expression per se, has_circ_0020397 did inhibit miR-138 activity, as examined via the expression of miR-138 targets telomerase reverse transcriptase (TERT) and programmed death-ligand 1 (PD-L1). PMID: 28707774
  68. The hTERT mRNA levels are frequently upregulated in peripheral blood and CTCs in the patients with nasopharyngeal carcinoma (NPC) and also the overexpression of hTERT mRNA correlated with clinicopathological parameters of NPC. PMID: 28693532
  69. results indicate that KMT2A promotes melanoma growth by activating the hTERT signaling, suggesting that the KMT2A/hTERT signaling pathway may be a potential therapeutic target for melanoma. PMID: 28726783
  70. RAS-ERK signaling in BRAF mutant melanomas is critical for regulating active chromatin state and recruitment of RNA polymerase II at mutant TERT promoters. Our study provides evidence that the mutant TERT promoter is a key substrate downstream of the RAS-ERK pathway. PMID: 27911794
  71. The TERT(C228T) mutation status was an independent prognostic factor for recurrence-free survival (hazard ratio = 3.08 [confidence interval 1.042-9.079]; p = 0.042) in patients with papillary thyroid carcinoma in multivariate analysis PMID: 27184112
  72. the results suggest that the C250T hTERT promoter mutation and telomere length assessment may serve as important molecular markers of HNSCC progression. PMID: 28535013
  73. there is an association between telomere length, telomerase activity, hTERT expression and alpha1-antitrypsin deficiency phenotypes PMID: 27390278
  74. These data suggest that TERT promoter mutations contribute to tumorigenesis by promoting immortalization and genomic instability in two phases. PMID: 28818973
  75. Our data suggest that Kras mutations increase telomerase activity and telomere length by activating the RAS/MEK pathway, which contributes to an aggressive phenotype of NSCLC. PMID: 27329725
  76. mutations in TERT promoter disclose the significance of both nuclear and cytoplasmic TERT in HCC. Cytoplasmic TERT should also be considered when determining prognosis and treatment of HCCs. PMID: 28460432
  77. expression of TERT does not differ in neoplastic and nonneoplastic pituitary tissues PMID: 28272680
  78. TERT mutations may be associated with shorter survival of glioma patients. PMID: 27206431
  79. We demonstrate that mature HCV core protein of 173 amino acids, but not the full-length form of 191 amino acids, can suppress miR-138 expression. TERT can be a direct target of miR-138 in hepatocellular carcinoma (HCC) cells. Further, TERT-targeting miR-138 supplementation can prevent HCV core protein from repressing HCC cell replicative senescence. PMID: 28258280
  80. We may conclude that hTERT promotes GIM by up-regulating CDX2 via NF-kappaB signaling pathway. PMID: 28460480
  81. Our study indicates that TERT rs2853676 polymorphisms correlate with glioma survival and recurrence rates in a Chinese population, which suggests that they could potentially serve as prognostic markers in glioma patients. PMID: 27655710
  82. Tianshengyuan-1 induced hypomethylation within TERT core promoter in HL60 cells but induced hypermethylation within TERT core promoter in normal peripheral blood mononuclear cells and CD34+ hematopoietic stem cells. PMID: 28002788
  83. pediatric papillary thyroid carcinomas in Japan are characterized by more advanced clinicopathological features, lower BRAF (V600E) frequency, and absence of TERT mutation PMID: 28176151
  84. THOR hypermethylation signature of the TERT promoter may have a role in biochemical relapse in prostate cancer PMID: 27437772
  85. TERT polymorphisms may contribute to the development of esophageal cancer. PMID: 28060765
  86. No association between TERT expression in non-small-cell lung cancer specimens and survival rates was found.A significant difference in TERT expression between two types of histopathological patterns adenocarcinoma and squamous cell carcinoma was detected in the non-small-cell lung cancer specimens. PMID: 29141053
  87. galectin-3 is an important regulator of hTERT expression and telomeric activity in gastric tumorigenesis PMID: 27494887
  88. Proliferating tumor stem cells with high telomerase expression are suitable targets for CDK4/6 inhibitor, palbociclib. PMID: 28039467
  89. Data show that telomerase (TERT) promoter and beta-1 catenin (CTNNB1) mutations were only observed in hepatocellular carcinomas but not in precursor lesions. PMID: 27661004
  90. FOXE1 interacts with ELK1 on thyroid relevant gene promoters, establishing a new regulatory pathway for its role in adult thyroid function. Co-regulation of TERT suggests a mechanism by which allelic variants in/near FOXE1 are associated with thyroid cancer risk. PMID: 27852061
  91. Report an association between TERT and gastric cancer susceptibility in the Chinese Han population. PMID: 27825130
  92. After adjusting for potential confounding, multivariate analyses indicated a three-fold increase in the odds of the TERT mutation for those with the mixed subtype compared with the pure subtype (P=0.04, adjusted odds ratio =3.32). PMID: 27244099
  93. This multicenter data analysis establishes a six-genotype genetic prognostic model for poor outcomes of papillary thyroid cancer with a risk order of genetic duet of BRAF V600E/RAS mutation and TERT mutation >>>>BRAF V600E = TERT mutation alone >RAS mutation alone = wild-type genes. PMID: 27875244
  94. results provide new insights into understanding the regulatory mechanism of cancer stem cells and suggest that the NMI-YY1-hTERT signaling axis may be a potential therapeutic target for breast cancers. PMID: 28492540
  95. No significant difference in the frequency of the TERT promoter mutation was observed between the persistence/recurrence group and the non-recurrence group in papillary thyroid cancer. PMID: 26727717
  96. mutations in TERT promoter and in CTNNB1 gene represent specific cancer signatures in the pathogenesis of viral related hepatocellular carcinoma. PMID: 27276713
  97. Biological assays have confirmed that growth inhibitory properties of tRES well correlate with the reduction of telomerase activity and hTERT gene transcript levels in human melanoma cells PMID: 28780124
  98. This study shown that M1 polarization strongly represses genes associated with the telomere complex. Importantly, both ischemia and Alzheimer's-like pathology recapitulated this cell type-specific pattern of reduced Tert mRNA expression in vivo. PMID: 27896432
  99. The data demonstrate that cells arrested in oncogene-induced cellular senescence retain the potential to escape senescence by mechanisms that involve derepression of TERT expression. PMID: 27503890
  100. genetic association studies in population in China: Data suggest that an SNP in TERT (rs2735940, C>T), an SNP associated with genetic predisposition for cancer, exhibits allele frequencies of 63% for allele C and 37% for allele T in the Chinese Han population studied. PMID: 29066480

Show More

Hide All

Involvement in disease Aplastic anemia (AA); Dyskeratosis congenita, autosomal dominant, 2 (DKCA2); Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 1 (PFBMFT1); Dyskeratosis congenita, autosomal recessive, 4 (DKCB4); Pulmonary fibrosis, idiopathic (IPF); Melanoma, cutaneous malignant 9 (CMM9)
Subcellular Location Nucleus, nucleolus, Nucleus, nucleoplasm, Nucleus, Chromosome, telomere, Cytoplasm, Nucleus, PML body
Protein Families Reverse transcriptase family, Telomerase subfamily
Tissue Specificity Expressed at a high level in thymocyte subpopulations, at an intermediate level in tonsil T-lymphocytes, and at a low to undetectable level in peripheral blood T-lymphocytes.
Database Links

HGNC: 11730

OMIM: 178500

KEGG: hsa:7015

STRING: 9606.ENSP00000309572

UniGene: Hs.492203

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1