Recombinant Human Telomerase reverse transcriptase (TERT), partial

In Stock Promotion
Code CSB-EP023391HU
Abbreviation Recombinant Human TERT protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
others
Alternative Names
CMM9; DKCA2; DKCB4; EST2; HEST2; htert; hTRT; PFBMFT1; TCS1; Telomerase associated protein 2; Telomerase catalytic subunit; Telomerase reverse transcriptase; Telomerase-associated protein 2; Telomere Reverse Transcriptase; TERT; TERT_HUMAN; TP2; TRT
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
281-436aa
Target Protein Sequence
EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant human telomerase reverse transcriptase (TERT) is generated by expressing the gene fragment corresponding to amino acids 281-436 of the human TERT in E.coli. This recombinant TERT protein is fused with a 6xHis-tag at the N-terminus. The 6xHis-tag allows for metal affinity chromatography-mediated purification of the fusion protein. The purity of this protein reaches up to 85% measured by SDS-PAGE. It migrated to the molecular weight band of 20-23 kDa. This protein is in stock now. The target protein TERT is a catalytic subunit of the enzyme telomerase, which together with the TERC comprises the most important unit of the telomerase complex. Telomerase is the enzyme required for the addition of telomeric repeats to the ends of linear chromosomes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'-TTAGGG-3'. The catalytic cycle involves primer binding, primer extension and release of product once the template boundary has been reached or nascent product translocation followed by further extension. More active on substrates containing 2 or 3 telomeric repeats. Telomerase activity is regulated by a number of factors including telomerase complex-associated proteins, chaperones and polypeptide modifiers. Modulates Wnt signaling. Plays important roles in aging and antiapoptosis.
Gene References into Functions
  1. Results not only identify quadruplex formation in the first exon promoted by CpG dinucleotide methylation as a regulator of hTERT expression but also provide a possible mechanistic insight into the regulation of gene expression via secondary DNA structures. PMID: 29084850
  2. Findings indicate a critical role for hTERT in regulating the epigenetic clock, in addition to its established role of compensating for cell replication-dependent telomere shortening. PMID: 29374233
  3. CTC1-STN1 terminates TERT while STN1-TEN1 enables C-strand synthesis during telomere replication in colon cancer cells. PMID: 30026550
  4. Results show that TERT promoter (TERTp) mutations were detected in 8.5% of papillary thyroid carcinomas (PTCs) with the C228T mutation being the most frequent. Moreover, three novel TERTp alterations were identified, which may play a role in PTC aggressiveness. Also, TERTp hotspot mutations were highly correlated with BRAF V600E mutation and their coexistence was significantly associated with gender and advanced stage. PMID: 30200646
  5. Presence of TERT promoter mutation is associated with shorter progression free survival and overall survival in meningiomas WHO grade II and III PMID: 29808339
  6. These data suggest that genetic and epigenetic alterations of TERT are associated with TERT upregulation and may predict clinical outcomes in and young adults melanoma. PMID: 28378855
  7. We further characterized those epitopes using enzyme-linked immunosorbent assay, and here we discuss the critical epitope of an anti-TERT mAb, which is applicable for immunohistochemical analysis PMID: 30004263
  8. TERT-p in spitzoid lesions is not necessarily a predictor of poor prognosis PMID: 27930864
  9. there is an association between TERT promoter mutations and MC1R variants in melanoma patients PMID: 27930874
  10. The results indicate that the association with chr5p15.33-Region 2 may be explained by rs36115365, a variant influencing TERT expression via ZNF148 in a manner consistent with elevated TERT in carriers of the C allele. PMID: 28447668
  11. The identified uncommon TERT promoter mutations exacerbate the poor prognosis characteristic of ovarian clear cell carcinoma cases, and the hotspot mutations appear to be a molecular feature of the adenofibroma-associated form of the disease. PMID: 29474637
  12. hTERT contains a BH3-like motif, a short peptide sequence found in BCL-2 family proteins, and interacts with anti-apoptotic BCL-2 family proteins MCL-1 and BCL-xL PMID: 29937479
  13. TERT mutation predicted malignant behavior in three cases of follicular thyroid tumors. PMID: 29860621
  14. the combination of the TERT promoter/BRAFV600E mutations and Ki-67 LI is a promising marker to predict recurrence of PTC. PMID: 28150740
  15. our study verified the correlations of TGFBR2 and hTERT in vitro and suggests that TGFBR2 and hTERT expression may be used as a diagnostic biomarker for cervical dysplasia and carcinoma. PMID: 28195144
  16. epigenetic alterations of the TERT promoter are frequent and associated with advanced disease and poorer clinical outcome in adrenocortical carcinoma. PMID: 29956721
  17. TERT promoter mutations are conserved in the majority of morphologically, spatially and temporally distinct components of a given urothelial carcinoma PMID: 28741734
  18. hTERT Genetic Polymorphisms and Leukocyte Telomere Length Shortenings are associated with Childhood Acute Lymphoblastic Leukemia. PMID: 29936725
  19. TERT Promoter Mutation and Telomere Length is associated with Salivary Gland Tumors. PMID: 28664476
  20. hTERT promoter methylation status revealed non-significant trend towards increase in methylation frequency in head and neck cancer patients compared to healthy individuals. PMID: 30088231
  21. TERT could induce thyroid carcinoma cell proliferation mainly through the PTEN/AKT signaling pathway. PMID: 29901196
  22. There was significant prognostic difference among the 4 glioma subtypes. Combined IDH and TERT gene mutation analysis may be useful for prognostic subgrouping. Notably, IDH1 wild-type cases can be further subdivided into TERT(+ ) or (-) subgroups with significant prognostic difference. PMID: 30220117
  23. EGF significantly upregulated RFPL3 and hTERT protein levels in the nonsmall cell lung cancer cells. RFPL3 and hTERT proteins upregulation by EGF were attenuated by pretreatment with AG1478 and erlotinib. EGF promoted proliferation and inhibited apoptosis; PD98059 decreased RFPL3 and hTERT protein expression; and RFPL3 overexpression increased the expression of hTERT and related MEKpathway proteins PMID: 29749533
  24. TERT protein expression may be regulated by several mechanisms in addition to its promoter mutation. PMID: 29693015
  25. Letter: TERT promoter mutation is a genetic cognate of urothelial papilloma, papillary urothelial neoplasm of low malignant potential and urothelial carcinoma, further supporting the hypothesis that TERT mutation is a frequent and early step in the transformation of many urothelial neoplasms. PMID: 28040359
  26. hTERT promoter mutations associate with aggressive histopathological features, indicating a role in tumour progression in solitary fibrous tumours. PMID: 29703757
  27. Here it was found that there was no statistical difference between human TERT rs2736109 G>A, rs2735940 T>C, rs2853669 A>G, rs2736098 G>A, and rs2736100 T>G polymorphisms that can be associated with risk of Breast Cancer in a Turkish population. PMID: 29506639
  28. the TERT promoter mutation may serve as a biomarker of prognostic stratification in patients with papillary urothelial neoplasm of low malignant potential PMID: 29193225
  29. TERT promoter mutations are very rare in urachal adenocarcinomas (unlike in urothelial carcinoma). PMID: 29047227
  30. Binary logistic regression analysis showed significant association of TERT rs2736100C with gallbladder carcinoma risk. PMID: 29450669
  31. We found that THOR is hypermethylated in pancreatic tumor tissue when compared with normal tissue and that THOR methylation correlates with TERT expression in tumor samples. Our preliminary findings support the diagnostic and prognostic values of THOR in pancreatic cancer. PMID: 29019414
  32. TERT structural rearrangements are associated with metastatic pheochromocytomas. PMID: 28974544
  33. occurrence of TERT promoter mutations has a pivotal role in the disease progression as a secondary genetic event at a time when tumor cells face the need for telomere elongation to allow further proliferation. PMID: 29463038
  34. TERT rs2736098: G>A genotype distribution did not differ significantly between patients with DLBCL and controls. PMID: 28967095
  35. that the rs401681 polymorphism in the TERT-CLPTM1L locus contributes to lung carcinogenesis only in patients harboring an EGFR mutation PMID: 29033187
  36. Mutated Liquid-based FNAs BRAF, N/HRAS and TERT mutations were significantly associated with malignancy regardless of the cytological classification PMID: 29094776
  37. TERT promoter mutations were likely to occur in BRAF V600E positive thyroid cancer. Patients with these 2 combined mutations were more likely to have a poor prognosis and outcome. PMID: 30024548
  38. maternal genetic variations in hTERT may play a contributory role in risk of PTL and PPROM PMID: 29771920
  39. the mutational status of BRAF, NRAS, and TERT promoter genes in 97 melanomas, was investigated. PMID: 29061376
  40. PSMA, TERT, and PDEF may serve as a reference for clinical diagnosis and as potential targets for the malignant tumor of the prostate therapeutics PMID: 28829509
  41. In chronic kidney disease patients, telomerase activity in PBMC was positively correlated with the CKD stage, serum creatinine, potassium and parathormone levels, and negatively correlated with estimated glomerular filtration rate, body mass index, platelet count and serum calcium levels. PMID: 28705647
  42. experimental evidence for association of higher plasma levels of hTERT with overall survival of both low and high grade patients, presenting hTERT as an independent prognostic marker. PMID: 28756592
  43. Tumor suppressor functions of MCPH1/BRIT1 and BRCA1; links with the inactivation of the functional form of hTERT and the activation of dominant negative splice variants of hTERT. PMID: 29860064
  44. results reveal that TERT promoter mutations may contribute significantly to biomarker-based classification of malignant gliomas. PMID: 28868656
  45. Although Genome-Wide Association studies have not been carried out in the field of alcohol-related hepatocellular carcinoma (HCC), common single nucleotide polymorphisms conferring a small increase in the risk of liver cancer risk have been identified. Specific patterns of gene mutations including CTNNB1, TERT, ARID1A and SMARCA2 exist in alcohol-related HCC. [review] PMID: 28296015
  46. Mutation frequency in promoter region in non-acral cutaneous metastatic melanoma. PMID: 27301352
  47. a papillary carcinoma harboring TERT promoter mutation is at higher risk for anaplastic transformation PMID: 28731042
  48. Meta-analysis: The combination of BRAF and TERT promoter mutations could classify PTCs into four distinct risk groups with decreasing aggressiveness as follows: coexisting BRAF and TERT > TERT alone=BRAF alone > no mutations. PMID: 28666074
  49. A total of 13 articles and 15 case-control studies, including 9,157 cases and 11,073 controls, were included in this meta-analysis. Overall, the pooled results indicated that the rs2853669 polymorphism was significantly associated with increased cancer risk in a homozygote comparison model. PMID: 29534075
  50. Authors identified two cancer-specific methylation sites (CpG1 and 2) in the TERT promoter in tumors from GIC patients. Methylated TERT promoter CpG sites 1 and 2 were detectable in patient stool, while only background levels were observed in healthy individuals. PMID: 28754720

Show More

Hide All

Involvement in disease
Aplastic anemia (AA); Dyskeratosis congenita, autosomal dominant, 2 (DKCA2); Pulmonary fibrosis, and/or bone marrow failure, telomere-related, 1 (PFBMFT1); Dyskeratosis congenita, autosomal recessive, 4 (DKCB4); Pulmonary fibrosis, idiopathic (IPF); Melanoma, cutaneous malignant 9 (CMM9)
Subcellular Location
Nucleus, nucleolus. Nucleus, nucleoplasm. Nucleus. Chromosome, telomere. Cytoplasm. Nucleus, PML body. Note=Shuttling between nuclear and cytoplasm depends on cell cycle, phosphorylation states, transformation and DNA damage. Diffuse localization in the nucleoplasm. Enriched in nucleoli of certain cell types. Translocated to the cytoplasm via nuclear pores in a CRM1/RAN-dependent manner involving oxidative stress-mediated phosphorylation at Tyr-707. Dephosphorylation at this site by SHP2 retains TERT in the nucleus. Translocated to the nucleus by phosphorylation by AKT.
Protein Families
Reverse transcriptase family, Telomerase subfamily
Tissue Specificity
Expressed at a high level in thymocyte subpopulations, at an intermediate level in tonsil T-lymphocytes, and at a low to undetectable level in peripheral blood T-lymphocytes.
Database Links

HGNC: 11730

OMIM: 178500

KEGG: hsa:7015

STRING: 9606.ENSP00000309572

UniGene: Hs.492203

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*