Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
CMM9; DKCA2; DKCB4; EST2; HEST2; htert; hTRT; PFBMFT1; TCS1; Telomerase associated protein 2; Telomerase catalytic subunit; Telomerase reverse transcriptase; Telomerase-associated protein 2; Telomere Reverse Transcriptase; TERT; TERT_HUMAN; TP2; TRT
Species
Homo sapiens (Human)
Expression Region
281-436aa
Target Protein Sequence
EATSLEGALSGTRHSHPSVGRQHHAGPPSTSRPPRPWDTPCPPVYAETKHFLYSSGDKEQLRPSFLLSSLRPSLTGARRLVETIFLGSRPWMPGTPRRLPRLPQRYWQMRPLFLELLGNHAQCPYGVLLKTHCPLRAAVTPAAGVCAREKPQGSVA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant human telomerase reverse transcriptase (TERT) is generated by expressing the gene fragment corresponding to amino acids 281-436 of the human TERT in E.coli. This recombinant TERT protein is fused with a 6xHis-tag at the N-terminus. The 6xHis-tag allows for metal affinity chromatography-mediated purification of the fusion protein. The purity of this protein reaches up to 85% measured by SDS-PAGE. It migrated to the molecular weight band of 20-23 kDa. This protein is in stock now. The target protein TERT is a catalytic subunit of the enzyme telomerase, which together with the TERC comprises the most important unit of the telomerase complex. Telomerase is the enzyme required for the addition of telomeric repeats to the ends of linear chromosomes.