Recombinant Human Tetraspanin-1 (TSPAN1), partial

In Stock
Code CSB-EP025146HU1
Abbreviation Recombinant Human TSPAN1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
TSPAN1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Tetraspan NET-1;Tetraspanin TM4-C
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
110-211aa
Target Protein Sequence
YTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. miR4913p is frequently downregulated in OS. miR4913p suppressed OS cell growth and invasion. TSPAN1 was identified to be a novel target of miR4913p. Overexpressed TSPAN1 conferred OS cell growth and invasion. PMID: 28849017
  2. TSPAN1 has a role in prostate cancer progression and is a marker for early biochemical recurrence after radical prostatectomy PMID: 27556508
  3. The present study demonstrated that Tspan1 plays an important role in Pancreatic cancer carcinogenic progression, including migration and invasion. PMID: 26370588
  4. Restoration of TSPAN1 rescued the effects of miR-573 overexpression. Therefore, our findings suggest that the miR-573/TSPAN1 axis is important in the control of gastric carcinogenesis PMID: 26054975
  5. our current data demonstrate that miR-638 functions as a tumor suppressor in human colorectal carcinoma by inhibiting TSPAN1 PMID: 25301729
  6. TSPAN1 was proved to induce migration, and so up-regulation of TSPAN1 by miR-200a may explain why over-expressing miR-200a promotes NSCLC cells migration PMID: 23938385
  7. these data argue against a role for tetraspanin 1 as a genuine mediator of cell surface receptor signalling but rather document a role for tetraspanin 1 in the control of cervical cancer cell motility and invasion. PMID: 23754316
  8. data suggest that the NET-1 gene may play an important role in proliferation, migration and endocytosis in the development and progress of hepatocellular carcinoma PMID: 22378020
  9. Study provided the gene expression profile of HBV-related HCC and presented differential expression patterns of SATB-1, TM4SF-1 and ST-14 between cancerous and noncancerous tissues in patients with HBV-related HCC. PMID: 22088470
  10. These studies demonstrate for the first time that Tspan-1 is an interacting partner with human thiamine transporter-1 and that this interaction affects thiamine transporter-1 stability. PMID: 21836059
  11. TSPAN1 may be another important breast cancer suppressor gene belonging to the tetraspanin superfamily. PMID: 20680643
  12. RNAi-mediated downregulation of TSPAN1 expression significantly inhibits the proliferation and invasion of colon cancer cells in vitro. PMID: 21302622
  13. The overexpression of Tspan-1 was found in HCC tissues, positively correlated with clinical stage and negatively correlated with survival rate. PMID: 20890423
  14. Data show that Tspan-1-EGFP expressed in ovarian carcinoma cells was detected mainly in lysosomes, but also in the plasma membrane and in the ER. PMID: 19508227
  15. Overexpression of NET-1 is associated with undifferentiated squamous cell carcinoma of cervical neoplasms PMID: 12115476
  16. Detection of NET-1 gene expression in liver biopsy may provide useful information about the biological behavior of hepatocellular carcinoma. PMID: 17913940
  17. Overexpression of TSPAN1 and Ki67 was negatively correlated with carcinoma differentiation, and the overexpression of TSPAN1 and CD34 was positively correlated with infiltration and lymph node status of the tumor. PMID: 18822690
  18. describe the generation of Tspan-1-specific antibodies and immunohistochemical staining of different subtypes of ovarian carcinomas that revealed significant differences in Tspan-1 expression that was pronounced in mucinous and endometrioid tumors PMID: 19017553

Show More

Hide All

Subcellular Location
Lysosome membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Database Links

HGNC: 20657

OMIM: 613170

KEGG: hsa:10103

STRING: 9606.ENSP00000361072

UniGene: Hs.38972

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*