Recombinant Human Titin (TTN), partial

In Stock
Code CSB-EP025267HU1(F6)
Abbreviation Recombinant Human TTN protein, partial
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP150794h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TTN.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP150794h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TTN.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
MPRM; Cardiomyopathy dilated 1G (autosomal dominant); CMD1G; CMH 9; CMH9; CMPD 4; CMPD4; Connectin; DKFZp451N061; EOMFC; FLJ26020; FLJ26409; FLJ32040; FLJ34413; FLJ39564; FLJ43066; HMERF; LGMD2J; MU RMS 40.14; MYLK5; Rhabdomyosarcoma antigen; Rhabdomyosarcoma antigen MU RMS 40.14; Rhabdomyosarcoma antigen MU-RMS-40.14; Titin; TITIN_HUMAN; TMD; TTN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
5398-5604aa
Target Protein Sequence
VFKCSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIRNVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKKSKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDCYAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEESGTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.5kDa
Protein Length
Partial of Isoform 6
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Titin (TTN) is expressed in E. coli, covering the amino acid region 5398-5604 of Isoform 6. This protein carries an N-terminal 6xHis tag, which helps with purification and detection. SDS-PAGE analysis shows the protein appears to reach purity levels above 90%. The recombinant protein is produced under stringent conditions to keep endotoxin levels low, which should make it suitable for various research applications.

Titin plays a crucial role in muscle physiology - it's known for its involvement in muscle contraction and elasticity. As the largest protein in the human body, titin contributes to the structural integrity and function of the sarcomere, the basic unit of muscle contraction. Research on titin may be essential for understanding muscular disorders and the biomechanics of how muscles work.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant human TTN fragment (5398-5604aa) is produced in an E. coli expression system with an N-terminal 6xHis-tag. TTN is a giant eukaryotic structural protein with complex domain architecture, requiring precise folding and stability for its role in sarcomere assembly. E. coli expression systems often struggle with the correct folding of large eukaryotic protein fragments due to the lack of eukaryotic chaperones and post-translational modifications. The partial nature of the fragment (206 amino acids) may not fully represent the native domain structure, and the His-tag could potentially interfere with folding or function. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., circular dichroism, functional binding assays) are provided. Therefore, the protein's folding status and bioactivity cannot be confirmed and are likely compromised.

1. Protein-Protein Interaction Studies

If the recombinant TTN fragment is correctly folded (unverified), it could be used to study protein interactions within the sarcomere, as the His-tag facilitates immobilization for pull-down assays. However, if misfolded (probable in E. coli), the fragment may exhibit non-specific binding or fail to recognize genuine biological partners, leading to misleading conclusions about sarcomere assembly. The His-tag might sterically hinder interaction sites even with correct folding.

2. Antibody Development and Validation

This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The high purity reduces cross-reactivity, and the defined fragment allows for region-specific antibody production. However, if misfolded, generated antibodies may not optimally recognize conformation-dependent epitopes of native titin in biological contexts, requiring additional validation.

3. Structural and Biophysical Characterization

If correctly folded, the fragment could be used for biophysical analyses to understand domain properties, but the His-tag may interfere with structural signals. If misfolded, data from techniques like circular dichroism or dynamic light scattering would misrepresent the native protein's architecture, leading to incorrect insights into titin's modular structure.

4. In Vitro Binding Assays

If properly folded, the His-tagged fragment could be used in ELISA or other binding assays, but if misfolded, results would not reflect biological relevance, potentially identifying false interactions. The tag-oriented immobilization may alter binding site accessibility, compromising assays for drug discovery or protein-ligand studies.

Final Recommendation & Action Plan

Given the high risk of misfolding due to E. coli expression and the complex nature of titin, it is essential to validate the protein's folding and functionality before any application. The recommended action plan includes first performing biophysical characterization (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) and functional assays (e.g., binding studies with known titin partners) to confirm native conformation. If validation fails, consider using eukaryotic expression systems (e.g., mammalian or insect cells) for better folding or obtain a commercially validated titin fragment. For immediate use, proceed with antibody development but validate antibodies against native protein, and avoid functional studies until proper folding is confirmed. Always include appropriate controls and use tag-free versions if possible for structural or interaction studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Key component in the assembly and functioning of vertebrate striated muscles. By providing connections at the level of individual microfilaments, it contributes to the fine balance of forces between the two halves of the sarcomere. The size and extensibility of the cross-links are the main determinants of sarcomere extensibility properties of muscle. In non-muscle cells, seems to play a role in chromosome condensation and chromosome segregation during mitosis. Might link the lamina network to chromatin or nuclear actin, or both during interphase.
Gene References into Functions
  1. Among the 120 dilated cardiomyopathy patients, 20 (16.7%) had TTN truncating variants. PMID: 29386531
  2. In a case-control study, there was a statistically significant association between an LOF variant in the TTN gene and early-onset AF, with the variant present in a small percentage of participants with early-onset AF (the case group). PMID: 30535219
  3. novel titin gene-truncating mutation NM_001267550: p.Leu23499fs/c.70497_40498insT found in the proband as well as in her mother in woman with peripartum cardiomyopathy PMID: 29997384
  4. Titin isoform expression differs in aortic stenosis and aortic regurgitation as adaptive response to different pathophysiologic scenarios. PMID: 29472025
  5. TTN missense variants were commonly identified in arrhythmogenic cardiomyopathy patients in this cohort, but did not appear to play a primary role in ACM as causative variants. PMID: 29750433
  6. This is the first study to suggest the involvement of the novel missense CACNA1C c.1786G>A and TTN c.49415G>A variants in the inheritance of symptomatic bradycardia and development of sick sinus syndrome. PMID: 29568937
  7. We employed WES to detect the mutations of DCM patients and identified 2 novel mutations. Our study expands the spectrum of TTN mutations and offers accurate genetic testing information for DCM patients who are still clinically negative. PMID: 27544385
  8. urinary concentration of titin correlated significantly with serum creatine kinase concentration, the best-known biomarker of Duchenne muscular dystrophy; the N-terminal fragment of titin in urine has potential as a diagnostic and clinical biomarker for DMD PMID: 29175173
  9. we considered titin fragments as promising candidates for reliable and non-invasive biomarkers of muscle injury. PMID: 27991570
  10. TTN plays a role in regulation of cardiac electrical conductance and coupling, and is a risk factor for cardiac arrhythmias and sudden cardiac death PMID: 27321809
  11. The T-allele at rs10497520 in the TTN gene is associated with shorter skeletal muscle fascicle length and conveys an advantage for marathon running performance in habitually trained men. PMID: 28581678
  12. An overview of the different neuromuscular disorders caused by mutations in the TTN gene, reviewing the molecular findings as well as the clinical data (review). PMID: 27854229
  13. This review considers data on structural and functional features of titin, on the role of this protein in determination of mechanical properties of sarcomeres, and on specific features of regulation of the stiffness and elasticity of its molecules, and possible amyloid aggregation of this protein PMID: 29523065
  14. Exome sequencing was conducted and a novel mutation c.107788T>C (p.W35930R) in the titin gene (TTN) was identified. PMID: 26392295
  15. Study found that there is a missense mutation in the TTN gene, c.100126A > G (p.Thr33376Ala), in a family whose members suffer from familial dilated cardiomyopathy. TTN is closely related to dilated cardiomyopathy and is an important causative gene of familial dilated cardiomyopathy. PMID: 29109008
  16. Truncating titin mutations cause a mild and treatable form of dilated cardiomyopathy. PMID: 27813223
  17. Activation of titin protein represents an initial step forward adaptive remodelling of the exercised muscle and may also be involved in the initiation of myofibre repair. PMID: 28712031
  18. Novel A178D missense mutation in titin is a cause of a highly penetrant familial cardiomyopathy with features of left ventricular noncompaction. PMID: 27625337
  19. Quantitative models derived from large-scale human genetic and phenotypic data can be applied to truncating mutations in titin in dilated cardiomyopathy. PMID: 27625338
  20. Variants near TTN and CCDC8 were associated with KI67 expression, and rs2288563 and rs2562832 in TTN are potential biomarkers for the prediction of clinical outcomes in hepatitis B-related hepatocellular carcinoma patients. PMID: 28700999
  21. Recent studies classify pathogenic variants in the TTN gene as the main responsible for Familial Dilated Cardiomyopathy. PMID: 27736720
  22. TTNtv might be a genetic modifier of HCM and confer an increased risk for cardiovascular death. PMID: 28822653
  23. Heterozygous loss of RBM20 suffices to profoundly impair myocyte biomechanics by its disturbance of TTN splicing causing dilated cardiomyopathy. PMID: 27496873
  24. Study identified a probable association between variation in TTN gene and patients with sudden unexpected death syndrome. PMID: 28704380
  25. We report that missense variant in the A-band of TTN gene is the strongest candidate mutation for autosomal-dominant inguinal hernia with incomplete penetrance. PMID: 27115767
  26. Titin-truncating variant is associated with dilated cardiomyopathy. PMID: 27869827
  27. Data suggest that disulfide bonds can alter mechanical stability of proteins in different ways depending on properties of system. Disulfide-bonded E coli FimG (minor component of type 1 fimbriae) undergoes a 30% increase in its mechanical stability compared with its reduced counterpart. Unfolding force of human titan I91 domain exhibits decrease of 15% relative to the wild-type form. PMID: 28642368
  28. TTN truncating variants were observed in nearly one fourth of young dilated cardiomyopathy patient population, in vast majority without conduction system disease. PMID: 28045975
  29. detected an Linkage Disequilibrium block associated with a rapid functional decline in patients with sporadic ALS, which is linked to decreased expression of TTN. PMID: 26746183
  30. An estimated probability of pathogenicity of TTN truncating mutations affecting all transcripts of TTN, identified in unselected dilated cardiomyopathy patients is 97.8%. PMID: 26777568
  31. TTN variant segregated with hypertrophic cardiomyopathy in affected members of the family. PMID: 28223422
  32. A distinct phenotype for patients with distal myopathy is associated with novel recessive TTN variants including a Serbian founder variant. PMID: 28295036
  33. Results show that the titin I27Y9P variant has similar mechanical stability as the wildtype. PMID: 27021163
  34. Phosphorylating Titin's Cardiac N2B Element by ERK2 or CaMKIIdelta Lowers the Single Molecule and Cardiac Muscle Force PMID: 26682816
  35. Suggest a potential biological role for some TTN missense variants in dilated cardiomyopathy. PMID: 26567375
  36. Data suggest that titin functions as an integrated protein chain where functionalities emerge from the joint action of titan and other sarcomere/A-band components (such as TCAP); titin exhibits tertiary elasticity and molecular shape memory. [REVIEW] PMID: 26517893
  37. a large number of VUS in the TTN gene were identified from a cohort of samples from patients suffering cardiac diseases associated with sudden cardiac death. PMID: 26516846
  38. TTN mutations have been strongly associated with four cardiomyopathies: Dilated cardiomyopathy, Hypertrophic cardiomyopathy, Arrhythmogenic right ventricular cardiomyopathy and Restrictive cardiomyopathy. PMID: 26024954
  39. The distribution of truncating variants in a large series of women with peripartum cardiomyopathy was remarkably similar to that found in patients with idiopathic dilated cardiomyopathy. PMID: 26735901
  40. Cleavage of C-terminal titin by CAPN3 is associated with limb-girdle muscular dystrophy 2A and tibial muscular dystrophy. PMID: 25877298
  41. findings indicate that titin mutations cause dilated cardiomyopathy by disrupting critical linkages between sarcomerogenesis and adaptive remodeling PMID: 26315439
  42. Engineered all four of the naturally occurring human M10 (the extreme C-terminus of titin) missense mutants and biophysically characterized them in vitro. PMID: 25739468
  43. an increase in intracellular Ca(2+) concentration leads to Ca(2+) binding to the PEVK region of titin. PMID: 25421125
  44. An increase in the degree of titin phosphorylation results in increased proteolytic degradation of this protein, that contributes to the development of skeletal muscle atrophy. PMID: 26394485
  45. TTNtv is the most common genetic cause of dilated cardiomyopathy in ambulant patients PMID: 25589632
  46. MMP-2 degraded Titin fragment in serum is related to induction of skeletal muscle atrophy. PMID: 25077715
  47. individual subfragments of titin and myomesin composed of Fn type III and Ig-like domains can activate expression of two IGF-1 splice forms in cultured myoblasts PMID: 25152160
  48. Patients with hypertension and heart failure with preserved ejection fraction had an increase in S11878(S26), no change in S12022(S170) and a decrease in S4185(S469). There were no significant differences between HTN(-)HFpEF or controls at these 3 sites. PMID: 25637629
  49. Results suggest that mutation in TTN could be implicated in the pathogenesis of puerperal cardiomyopathies. PMID: 24558114
  50. this study presents here the X-ray structure of the human titin:obscurin M10:O1 complex extending our previous work on the M10:OL1 interaction. PMID: 25490259

Show More

Hide All

Involvement in disease
Hereditary myopathy with early respiratory failure (HMERF); Cardiomyopathy, familial hypertrophic 9 (CMH9); Cardiomyopathy, dilated 1G (CMD1G); Tardive tibial muscular dystrophy (TMD); Limb-girdle muscular dystrophy 2J (LGMD2J); Salih myopathy (SALMY)
Subcellular Location
Cytoplasm. Nucleus.
Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family
Tissue Specificity
Isoforms 3, 7 and 8 are expressed in cardiac muscle. Isoform 4 is expressed in vertebrate skeletal muscle. Isoform 6 is expressed in skeletal muscle (at protein level).
Database Links

HGNC: 12403

OMIM: 188840

KEGG: hsa:7273

STRING: 9606.ENSP00000343764

UniGene: Hs.134602

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*